Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	114990
Gene name	Vasorin
Gene symbol	VASN
Synonyms (NCBI Gene)	SLITL2
Chromosome	16
Chromosome location	16p13.3

128

Show/Hide all (128)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018355	hsa-miR-335-5p	Microarray	18185580
MIRT019949	hsa-miR-375	Microarray	20215506
MIRT022816	hsa-miR-124-3p	Microarray	18668037
MIRT031814	hsa-miR-16-5p	Proteomics	18668040
MIRT714521	hsa-miR-22-3p	HITS-CLIP	19536157
MIRT714520	hsa-miR-874-5p	HITS-CLIP	19536157
MIRT574106	hsa-miR-4690-5p	PAR-CLIP	20371350
MIRT574105	hsa-miR-2682-5p	PAR-CLIP	20371350
MIRT574104	hsa-miR-34b-5p	PAR-CLIP	20371350
MIRT574103	hsa-miR-449c-5p	PAR-CLIP	20371350
MIRT574101	hsa-miR-4514	PAR-CLIP	20371350
MIRT574102	hsa-miR-4692	PAR-CLIP	20371350
MIRT574100	hsa-miR-4308	PAR-CLIP	20371350
MIRT574099	hsa-miR-4254	PAR-CLIP	20371350
MIRT574098	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT574096	hsa-miR-7154-3p	PAR-CLIP	20371350
MIRT574097	hsa-miR-765	PAR-CLIP	20371350
MIRT574095	hsa-miR-6894-5p	PAR-CLIP	20371350
MIRT574094	hsa-miR-34a-5p	PAR-CLIP	20371350
MIRT574093	hsa-miR-34c-5p	PAR-CLIP	20371350
MIRT574091	hsa-miR-449a	PAR-CLIP	20371350
MIRT574092	hsa-miR-449b-5p	PAR-CLIP	20371350
MIRT574090	hsa-miR-203b-3p	PAR-CLIP	20371350
MIRT714521	hsa-miR-22-3p	HITS-CLIP	19536157
MIRT714520	hsa-miR-874-5p	HITS-CLIP	19536157
MIRT574106	hsa-miR-4690-5p	PAR-CLIP	20371350
MIRT574105	hsa-miR-2682-5p	PAR-CLIP	20371350
MIRT574104	hsa-miR-34b-5p	PAR-CLIP	20371350
MIRT574103	hsa-miR-449c-5p	PAR-CLIP	20371350
MIRT574101	hsa-miR-4514	PAR-CLIP	20371350
MIRT574102	hsa-miR-4692	PAR-CLIP	20371350
MIRT574100	hsa-miR-4308	PAR-CLIP	20371350
MIRT574099	hsa-miR-4254	PAR-CLIP	20371350
MIRT574098	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT574096	hsa-miR-7154-3p	PAR-CLIP	20371350
MIRT574097	hsa-miR-765	PAR-CLIP	20371350
MIRT574095	hsa-miR-6894-5p	PAR-CLIP	20371350
MIRT574094	hsa-miR-34a-5p	PAR-CLIP	20371350
MIRT574093	hsa-miR-34c-5p	PAR-CLIP	20371350
MIRT574091	hsa-miR-449a	PAR-CLIP	20371350
MIRT574092	hsa-miR-449b-5p	PAR-CLIP	20371350
MIRT574090	hsa-miR-203b-3p	PAR-CLIP	20371350
MIRT1482847	hsa-miR-1180	CLIP-seq
MIRT1482848	hsa-miR-122	CLIP-seq
MIRT1482849	hsa-miR-1254	CLIP-seq
MIRT1482850	hsa-miR-1288	CLIP-seq
MIRT1482851	hsa-miR-1343	CLIP-seq
MIRT1482852	hsa-miR-145	CLIP-seq
MIRT1482853	hsa-miR-1915	CLIP-seq
MIRT1482854	hsa-miR-193a-3p	CLIP-seq
MIRT1482855	hsa-miR-193b	CLIP-seq
MIRT1482856	hsa-miR-205	CLIP-seq
MIRT1482857	hsa-miR-214	CLIP-seq
MIRT1482858	hsa-miR-3116	CLIP-seq
MIRT1482859	hsa-miR-3124-3p	CLIP-seq
MIRT1482860	hsa-miR-3180-5p	CLIP-seq
MIRT1482861	hsa-miR-3199	CLIP-seq
MIRT1482862	hsa-miR-361-3p	CLIP-seq
MIRT1482863	hsa-miR-3619-5p	CLIP-seq
MIRT1482864	hsa-miR-4300	CLIP-seq
MIRT1482865	hsa-miR-4326	CLIP-seq
MIRT1482866	hsa-miR-4420	CLIP-seq
MIRT1482867	hsa-miR-4481	CLIP-seq
MIRT1482868	hsa-miR-4497	CLIP-seq
MIRT1482869	hsa-miR-4530	CLIP-seq
MIRT1482870	hsa-miR-4664-3p	CLIP-seq
MIRT1482871	hsa-miR-4745-5p	CLIP-seq
MIRT1482872	hsa-miR-4754	CLIP-seq
MIRT1482873	hsa-miR-4790-5p	CLIP-seq
MIRT1482874	hsa-miR-516a-3p	CLIP-seq
MIRT1482875	hsa-miR-658	CLIP-seq
MIRT1482876	hsa-miR-761	CLIP-seq
MIRT1482877	hsa-miR-920	CLIP-seq
MIRT1555377	hsa-miR-146b-3p	CLIP-seq
MIRT1555378	hsa-miR-339-5p	CLIP-seq
MIRT1555379	hsa-miR-4421	CLIP-seq
MIRT2145359	hsa-miR-1245b-3p	CLIP-seq
MIRT1482852	hsa-miR-145	CLIP-seq
MIRT2145360	hsa-miR-3150b-3p	CLIP-seq
MIRT1482860	hsa-miR-3180-5p	CLIP-seq
MIRT2145361	hsa-miR-342-3p	CLIP-seq
MIRT2145362	hsa-miR-377	CLIP-seq
MIRT1482865	hsa-miR-4326	CLIP-seq
MIRT2145363	hsa-miR-4422	CLIP-seq
MIRT2145364	hsa-miR-4689	CLIP-seq
MIRT2145365	hsa-miR-4784	CLIP-seq
MIRT2145359	hsa-miR-1245b-3p	CLIP-seq
MIRT2145360	hsa-miR-3150b-3p	CLIP-seq
MIRT1482861	hsa-miR-3199	CLIP-seq
MIRT2145361	hsa-miR-342-3p	CLIP-seq
MIRT2365586	hsa-miR-3622a-5p	CLIP-seq
MIRT2145362	hsa-miR-377	CLIP-seq
MIRT1482865	hsa-miR-4326	CLIP-seq
MIRT2365587	hsa-miR-4423-3p	CLIP-seq
MIRT2145364	hsa-miR-4689	CLIP-seq
MIRT2145365	hsa-miR-4784	CLIP-seq
MIRT1482853	hsa-miR-1915	CLIP-seq
MIRT2145362	hsa-miR-377	CLIP-seq
MIRT2659297	hsa-miR-4287	CLIP-seq
MIRT2659298	hsa-miR-4469	CLIP-seq
MIRT2659299	hsa-miR-4685-3p	CLIP-seq
MIRT2659300	hsa-miR-642a	CLIP-seq
MIRT2659301	hsa-miR-767-3p	CLIP-seq
MIRT1482847	hsa-miR-1180	CLIP-seq
MIRT2694914	hsa-miR-146a	CLIP-seq
MIRT2694915	hsa-miR-146b-5p	CLIP-seq
MIRT1482857	hsa-miR-214	CLIP-seq
MIRT1482859	hsa-miR-3124-3p	CLIP-seq
MIRT1482863	hsa-miR-3619-5p	CLIP-seq
MIRT2694916	hsa-miR-3650	CLIP-seq
MIRT2694917	hsa-miR-3688-5p	CLIP-seq
MIRT2145362	hsa-miR-377	CLIP-seq
MIRT2659297	hsa-miR-4287	CLIP-seq
MIRT1482864	hsa-miR-4300	CLIP-seq
MIRT2694918	hsa-miR-4459	CLIP-seq
MIRT2659298	hsa-miR-4469	CLIP-seq
MIRT1482868	hsa-miR-4497	CLIP-seq
MIRT1482870	hsa-miR-4664-3p	CLIP-seq
MIRT2659299	hsa-miR-4685-3p	CLIP-seq
MIRT2694919	hsa-miR-4722-5p	CLIP-seq
MIRT2694920	hsa-miR-4779	CLIP-seq
MIRT2694921	hsa-miR-589	CLIP-seq
MIRT2659300	hsa-miR-642a	CLIP-seq
MIRT2694922	hsa-miR-644	CLIP-seq
MIRT1482876	hsa-miR-761	CLIP-seq
MIRT2659301	hsa-miR-767-3p	CLIP-seq
MIRT2694923	hsa-miR-885-3p	CLIP-seq
MIRT1482877	hsa-miR-920	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	15247411, 21170088
GO:0005739	Component	Mitochondrion	IEA
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0009986	Component	Cell surface	IDA	15247411
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IMP	21170088
GO:0016020	Component	Membrane	IEA
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IBA
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IDA	15247411
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IMP	21170088
GO:0038023	Function	Signaling receptor activity	IBA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0050431	Function	Transforming growth factor beta binding	IBA
GO:0050431	Function	Transforming growth factor beta binding	IPI	15247411
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070062	Component	Extracellular exosome	IDA	21082674
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071461	Process	Cellular response to redox state	IEA

MIM	HGNC	e!Ensembl
608843	18517	ENSG00000168140

Q6EMK4

Protein name

Vasorin (Protein slit-like 2)

Protein function

May act as an inhibitor of TGF-beta signaling.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13855	LRR_8	56 → 112	Leucine rich repeat	Repeat
PF13855	LRR_8	100 → 160	Leucine rich repeat	Repeat
PF13855	LRR_8	192 → 250	Leucine rich repeat	Repeat
PF00008	EGF	409 → 440	EGF-like domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed at highest levels in aorta, at intermediate levels in kidney and placenta and at lowest levels in brain, heart, liver, lung and skeletal muscle. Within the aorta, the strongest expression is found in the tunica media of the p

Sequence

MCSRVPLLLPLLLLLALGPGVQGCPSGCQCSQPQTVFCTARQGTTVPRDVPPDTVGLYVF
ENGITMLDAGSFAGLPGLQLLDLSQNQIASLPSGVFQPLANLSNLDLTANRLHEITNETF
RGLRRLERLYLGKNRIRHIQPGAFDTLDRLLELKLQDNELRALPPLRLPRLLLLDLSHNS
LLALEPGILDTANVEALRLAGLGLQQLDEGLFSRLRNLHDLDVSDNQLERVPPVIRGLRG
LTRLRLAGNTRIAQLRPEDLAGLAALQELDVSNLSLQALPGDLSGLFPRLRLLAAARNPF
NCVCPLSWFGPWVRESHVTLASPEETRCHFPPKNAGRLLLELDYADFGCPATTTTATVPT
TRPVVREPTALSSSLAPTWLSPTEPATEAPSPPSTAPPTVGPVPQPQDCPPSTCLNGGTC
HLGTRHHLACLCPEGFTGLYCESQMGQGTRPSPTPVTPRPPRSLTLGIEPVSPTSLRVGL
QRYLQGSSVQLRSLRLTYRNLSGPDKRLVTLRLPASLAEYTVTQLRPNATYSVCVMPLGP
GRVPEGEEACGEAHTPPAVHSNHAPVTQAREGNLPLLIAPALAAVLLAALAAVGAAYCVR
RGRAMAAAAQDKGQVGPGAGPLELEGVKVPLEPGPKATEGGGEALPSGSECEVPLMGFPG
PGLQSPLHAKPYI

Sequence length

673

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (34)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	32792518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30888555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25826090	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31760267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	36614132	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	31505229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	32792518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	35170203	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	35170203	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	29198941	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31215106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31215106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29198941, 31215106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	29198941	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31215106	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	29198941	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35170203, 40594164	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30564578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	34565020	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25826090, 29725267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	25826090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	34565020	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30888555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	25826090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31760267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	31312369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31215106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29198941, 31215106, 31312369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular hypertension	Pubtator	35170203	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31819067, 32633347	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	31312369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	31312369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	40594164	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	31215106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

VASN (vasorin)