C1QTNF4 (C1q and TNF related 4)

Gene

• Entrez ID: 114900
• Gene name: C1q and TNF related 4
• Gene symbol: C1QTNF4
• Synonyms (NCBI Gene): CTRP4, ZACRP4
• Chromosome: 11
• Chromosome location: 11p11.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT842335	hsa-miR-4645-5p	CLIP-seq
MIRT842336	hsa-miR-4673	CLIP-seq
MIRT842337	hsa-miR-4783-5p	CLIP-seq
MIRT2385129	hsa-miR-4532	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002023	Process	Reduction of food intake in response to dietary excess	IEA
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	21658842
GO:0005615	Component	Extracellular space	IEA
GO:0010467	Process	Gene expression	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	21658842
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	21658842
GO:0070105	Process	Positive regulation of interleukin-6-mediated signaling pathway	IDA	21658842
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IEA
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IDA	21658842

Other IDs

• MIM: 614911
• HGNC: 14346
• e!Ensembl: ENSG00000172247

Protein

• UniProt ID: Q9BXJ3
• Protein name: Complement C1q tumor necrosis factor-related protein 4 (C1q/TNF-related protein 4)
• Protein function: May be involved in the regulation of the inflammatory network. Its role as pro- or anti-inflammatory seems to be context dependent (PubMed:21658842, PubMed:27086950). Seems to have some role in regulating food intake and energy balance when admi
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00386	C1q	31 → 156	C1q domain	Domain
  PF00386	C1q	178 → 311	C1q domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed at low levels (PubMed:21658842). Highest levels in adipocyte tissue and brain (PubMed:24366864). {ECO:0000269|PubMed:21658842, ECO:0000269|PubMed:24366864}.
• Sequence:

  MLPLLLGLLGPAACWALGPTPGPGSSELRSAFSAARTTPLEGTSEMAVTFDKVYVNIGGD
  FDVATGQFRCRVPGAYFFSFTAGKAPHKSLSVMLVRNRDEVQALAFDEQRRPGARRAASQ
  SAMLQLDYGDTVWLRLHGAPQYALGAPGATFSGYLVYADADADAPARGPPAPPEPRSAFS
  AARTRSLVGSDAGPGPRHQPLAFDTEFVNIGGDFDAAAGVFRCRLPGAYFFSFTLGKLPR
  KTLSVKLMKNRDEVQAMIYDDGASRRREMQSQSVMLALRRGDAVWLLSHDHDGYGAYSNH
  GKYITFSGFLVYPDLAPAAPPGLGASELL

• Sequence length: 329

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Autoimmune Diseases	Autoimmune disease	Pubtator	33676896	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	38286878	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	29177435, 33676896	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21658842, 30885436		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30885436		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30885436		★☆☆☆☆ Found in Text Mining only