C1QTNF1 (C1q and TNF related 1)

Gene

• Entrez ID: 114897
• Gene name: C1q and TNF related 1
• Gene symbol: C1QTNF1
• Synonyms (NCBI Gene): CTRP1, GIP, ZSIG37
• Chromosome: 17
• Chromosome location: 17q25.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019162	hsa-miR-335-5p	Microarray	18185580
MIRT030279	hsa-miR-26b-5p	Microarray	19088304
MIRT842202	hsa-miR-3120-3p	CLIP-seq
MIRT842203	hsa-miR-3163	CLIP-seq
MIRT842204	hsa-miR-340	CLIP-seq
MIRT842205	hsa-miR-4638-5p	CLIP-seq
MIRT842206	hsa-miR-4755-3p	CLIP-seq
MIRT842207	hsa-miR-4786-3p	CLIP-seq
MIRT842208	hsa-miR-759	CLIP-seq
MIRT842209	hsa-miR-214	CLIP-seq
MIRT842210	hsa-miR-3064-5p	CLIP-seq
MIRT842211	hsa-miR-3619-5p	CLIP-seq
MIRT842212	hsa-miR-3652	CLIP-seq
MIRT842213	hsa-miR-3689a-3p	CLIP-seq
MIRT842214	hsa-miR-3689c	CLIP-seq
MIRT842215	hsa-miR-4300	CLIP-seq
MIRT842216	hsa-miR-4430	CLIP-seq
MIRT842217	hsa-miR-4505	CLIP-seq
MIRT842218	hsa-miR-4530	CLIP-seq
MIRT842219	hsa-miR-4690-5p	CLIP-seq
MIRT842220	hsa-miR-635	CLIP-seq
MIRT842221	hsa-miR-761	CLIP-seq
MIRT842222	hsa-miR-920	CLIP-seq
MIRT1949602	hsa-miR-1275	CLIP-seq
MIRT1949603	hsa-miR-3074-5p	CLIP-seq
MIRT1949604	hsa-miR-4525	CLIP-seq
MIRT1949605	hsa-miR-4665-5p	CLIP-seq
MIRT1949606	hsa-miR-4722-3p	CLIP-seq
MIRT1949607	hsa-miR-4723-5p	CLIP-seq
MIRT1949608	hsa-miR-625	CLIP-seq
MIRT1949609	hsa-miR-637	CLIP-seq
MIRT1949602	hsa-miR-1275	CLIP-seq
MIRT2187645	hsa-miR-4420	CLIP-seq
MIRT1949604	hsa-miR-4525	CLIP-seq
MIRT1949605	hsa-miR-4665-5p	CLIP-seq
MIRT1949607	hsa-miR-4723-5p	CLIP-seq
MIRT1949608	hsa-miR-625	CLIP-seq
MIRT2464963	hsa-miR-1913	CLIP-seq
MIRT2464964	hsa-miR-28-5p	CLIP-seq
MIRT2464965	hsa-miR-3139	CLIP-seq
MIRT2464966	hsa-miR-3194-3p	CLIP-seq
MIRT2464967	hsa-miR-324-3p	CLIP-seq
MIRT2464968	hsa-miR-376a	CLIP-seq
MIRT2464969	hsa-miR-376b	CLIP-seq
MIRT2464970	hsa-miR-4749-3p	CLIP-seq
MIRT2464971	hsa-miR-665	CLIP-seq
MIRT2464972	hsa-miR-708	CLIP-seq
MIRT2491537	hsa-miR-1266	CLIP-seq
MIRT2491538	hsa-miR-1276	CLIP-seq
MIRT2491539	hsa-miR-1285	CLIP-seq
MIRT2491540	hsa-miR-1294	CLIP-seq
MIRT2491541	hsa-miR-1302	CLIP-seq
MIRT2491542	hsa-miR-185	CLIP-seq
MIRT2464963	hsa-miR-1913	CLIP-seq
MIRT2491543	hsa-miR-2467-5p	CLIP-seq
MIRT2464964	hsa-miR-28-5p	CLIP-seq
MIRT2491544	hsa-miR-298	CLIP-seq
MIRT2491545	hsa-miR-3122	CLIP-seq
MIRT2491546	hsa-miR-3126-5p	CLIP-seq
MIRT2464965	hsa-miR-3139	CLIP-seq
MIRT2491547	hsa-miR-3169	CLIP-seq
MIRT2491548	hsa-miR-3184	CLIP-seq
MIRT2491549	hsa-miR-3187-5p	CLIP-seq
MIRT2491550	hsa-miR-3188	CLIP-seq
MIRT2464966	hsa-miR-3194-3p	CLIP-seq
MIRT2464967	hsa-miR-324-3p	CLIP-seq
MIRT2491551	hsa-miR-342-5p	CLIP-seq
MIRT2491552	hsa-miR-3663-5p	CLIP-seq
MIRT2491553	hsa-miR-3664-3p	CLIP-seq
MIRT2464968	hsa-miR-376a	CLIP-seq
MIRT2464969	hsa-miR-376b	CLIP-seq
MIRT2491554	hsa-miR-3913-5p	CLIP-seq
MIRT2491555	hsa-miR-3945	CLIP-seq
MIRT2491556	hsa-miR-3975	CLIP-seq
MIRT2491557	hsa-miR-423-5p	CLIP-seq
MIRT2491558	hsa-miR-4253	CLIP-seq
MIRT2491559	hsa-miR-4292	CLIP-seq
MIRT2491560	hsa-miR-4298	CLIP-seq
MIRT2491561	hsa-miR-4306	CLIP-seq
MIRT2491562	hsa-miR-4311	CLIP-seq
MIRT2491563	hsa-miR-4436a	CLIP-seq
MIRT2491564	hsa-miR-4462	CLIP-seq
MIRT2491565	hsa-miR-4518	CLIP-seq
MIRT2491566	hsa-miR-4522	CLIP-seq
MIRT2491567	hsa-miR-4644	CLIP-seq
MIRT2491568	hsa-miR-4649-3p	CLIP-seq
MIRT2491569	hsa-miR-4651	CLIP-seq
MIRT2491570	hsa-miR-4664-5p	CLIP-seq
MIRT2491571	hsa-miR-4710	CLIP-seq
MIRT2491572	hsa-miR-4725-5p	CLIP-seq
MIRT2491573	hsa-miR-4740-5p	CLIP-seq
MIRT2464970	hsa-miR-4749-3p	CLIP-seq
MIRT2491574	hsa-miR-485-5p	CLIP-seq
MIRT2491575	hsa-miR-504	CLIP-seq
MIRT2491576	hsa-miR-509-3p	CLIP-seq
MIRT2491577	hsa-miR-583	CLIP-seq
MIRT2491578	hsa-miR-602	CLIP-seq
MIRT2491579	hsa-miR-608	CLIP-seq
MIRT2491580	hsa-miR-612	CLIP-seq
MIRT2464971	hsa-miR-665	CLIP-seq
MIRT2464972	hsa-miR-708	CLIP-seq
MIRT2491537	hsa-miR-1266	CLIP-seq
MIRT2491538	hsa-miR-1276	CLIP-seq
MIRT2491541	hsa-miR-1302	CLIP-seq
MIRT2464963	hsa-miR-1913	CLIP-seq
MIRT2491543	hsa-miR-2467-5p	CLIP-seq
MIRT2464964	hsa-miR-28-5p	CLIP-seq
MIRT2491544	hsa-miR-298	CLIP-seq
MIRT2491545	hsa-miR-3122	CLIP-seq
MIRT2491546	hsa-miR-3126-5p	CLIP-seq
MIRT2464965	hsa-miR-3139	CLIP-seq
MIRT2676774	hsa-miR-3159	CLIP-seq
MIRT2676775	hsa-miR-3162-5p	CLIP-seq
MIRT2491547	hsa-miR-3169	CLIP-seq
MIRT2491550	hsa-miR-3188	CLIP-seq
MIRT2464966	hsa-miR-3194-3p	CLIP-seq
MIRT2464967	hsa-miR-324-3p	CLIP-seq
MIRT2491552	hsa-miR-3663-5p	CLIP-seq
MIRT2491553	hsa-miR-3664-3p	CLIP-seq
MIRT2464968	hsa-miR-376a	CLIP-seq
MIRT2464969	hsa-miR-376b	CLIP-seq
MIRT2491554	hsa-miR-3913-5p	CLIP-seq
MIRT2491556	hsa-miR-3975	CLIP-seq
MIRT2676776	hsa-miR-4284	CLIP-seq
MIRT2676777	hsa-miR-4293	CLIP-seq
MIRT2491560	hsa-miR-4298	CLIP-seq
MIRT2491562	hsa-miR-4311	CLIP-seq
MIRT2676778	hsa-miR-4324	CLIP-seq
MIRT2491563	hsa-miR-4436a	CLIP-seq
MIRT2491564	hsa-miR-4462	CLIP-seq
MIRT2491565	hsa-miR-4518	CLIP-seq
MIRT2491566	hsa-miR-4522	CLIP-seq
MIRT2491568	hsa-miR-4649-3p	CLIP-seq
MIRT2491573	hsa-miR-4740-5p	CLIP-seq
MIRT2464970	hsa-miR-4749-3p	CLIP-seq
MIRT842206	hsa-miR-4755-3p	CLIP-seq
MIRT2491574	hsa-miR-485-5p	CLIP-seq
MIRT2491576	hsa-miR-509-3p	CLIP-seq
MIRT2676779	hsa-miR-513a-5p	CLIP-seq
MIRT2491577	hsa-miR-583	CLIP-seq
MIRT2491578	hsa-miR-602	CLIP-seq
MIRT2464971	hsa-miR-665	CLIP-seq
MIRT2464972	hsa-miR-708	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	12409230, 16189514, 25416956, 25910212, 32296183
GO:0005518	Function	Collagen binding	IDA	16195328
GO:0005576	Component	Extracellular region	IEA
GO:0005581	Component	Collagen trimer	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	18171693
GO:0005615	Component	Extracellular space	IEA
GO:0005886	Component	Plasma membrane	IDA	12409230
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IDA	18171693
GO:0010544	Process	Negative regulation of platelet activation	IDA	16195328
GO:0010628	Process	Positive regulation of gene expression	IDA	18171693
GO:0010906	Process	Regulation of glucose metabolic process	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0090331	Process	Negative regulation of platelet aggregation	IDA	16195328
GO:2000860	Process	Positive regulation of aldosterone secretion	IDA	18171693

Other IDs

• MIM: 610365
• HGNC: 14324
• e!Ensembl: ENSG00000173918

Protein

• UniProt ID: Q9BXJ1
• Protein name: Complement C1q tumor necrosis factor-related protein 1 (G protein-coupled receptor-interacting protein) (GIP)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01391	Collagen	97 → 144	Collagen triple helix repeat (20 copies)	Repeat
  PF00386	C1q	147 → 275	C1q domain	Domain

• Sequence:

  MGSRGQGLLLAYCLLLAFASGLVLSRVPHVQGEQQEWEGTEELPSPPDHAERAEEQHEKY
  RPSQDQGLPASRCLRCCDPGTSMYPATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAG
  ARGHTGPKGQKGSMGAPGERCKSHYAAFSVGRKKPMHSNHYYQTVIFDTEFVNLYDHFNM
  FTGKFYCYVPGLYFFSLNVHTWNQKETYLHIMKNEEEVVILFAQVGDRSIMQSQSLMLEL
  REQDQVWVRLYKGERENAIFSEELDTYITFSGYLVKHATEP

• Sequence length: 281

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, BASAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acromegaly	Acromegaly	BEFREE	30948746		★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	Pubtator	34334589	Associate	★☆☆☆☆ Found in Text Mining only
Acth-Independent Macronodular Adrenal Hyperplasia	Cushing`s Syndrome	BEFREE	14767469		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	22112810		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22112810		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11158012, 12099397, 16087722		★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	11994328, 12099397, 28931750, 8784063, 9745416, 9888586		★☆☆☆☆ Found in Text Mining only
Adrenal hyperplasia	Adrenal hyperplasia	BEFREE	10443649, 15705925		★☆☆☆☆ Found in Text Mining only
Adrenal Hyperplasia Congenital	Congenital adrenal hyperplasia	Pubtator	1325608	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	26198021	Associate	★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	28633506, 28666375, 29689362		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	CTD_human_DG	28633506, 28666375, 29689362		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	21786155, 27181102, 28625919, 29884547		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	21786155, 27181102, 28625919, 29884547		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	36151371	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	35202556	Stimulate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	35202556	Stimulate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	31682875, 31765668		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	33852173	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31292496		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	39273671	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	34177903	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	35123462	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	17624916, 25047836, 26395740, 28565879, 29765988, 31689454		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	17624916		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	20470376, 29765988, 34426508	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	31974732	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	26395740		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	31083558		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	30667131, 31608934		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	31198543		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	28552096		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	31121474		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29473979		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20433877		★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia	Congenital adrenal hyperplasia	BEFREE	10443649, 15705925		★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Congenital hyperinsulinism	Pubtator	25444530	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28810263, 29733904		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31001636		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	31081425		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	27169633	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29765988, 31051410, 31081425		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	29765988, 31974732, 34426508, 40135555	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	31081425		★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	BEFREE	10443649, 12099397, 15276624, 15326569, 15705925, 16772347, 17250952, 21264796, 28931750, 31572300, 8038906, 8784063, 9709947, 9745416, 9851802, 9888586		★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	LHGDN	12530694		★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing syndrome	Pubtator	1325608, 19581669, 28931750	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	30738804		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31283994		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12525257, 12800091, 14557471, 23568101, 28055305, 28096258, 28213130, 28290604, 28592636, 28610922, 28753646, 29402504, 29412820, 29683968, 29765988, 29947538, 30637966, 30667131, 30938196, 30948746, 31366085, 31697967, 31733230, 31738969, 31756326, 31756366, 31785994		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	21300845	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12525257, 12800091, 14557471, 23568101, 28055305, 28062192, 28096258, 28213130, 28290604, 28592636, 28610922, 28753646, 29402504, 29412820, 29683968, 29725390, 29765988, 29947538, 30637966, 30667131, 30938196, 30948746, 31366085, 31697967, 31733230, 31738969, 31756326, 31756366, 31785994		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	29765988, 36151371	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	40122442	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	17715056	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	19254363, 20374430, 20673334, 22237064, 24086540, 27042274, 27623947, 28073779, 28566273, 29358691, 31330984, 32390941, 33721395, 34426508, 34505161, 38049854	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10550415, 11679427, 11888847, 12242461, 12525257, 14669159, 14719796, 15331546, 15780432, 15983230, 16898571, 19254363, 20374430, 20421298, 20673334, 21356520, 21761282, 22237064, 23306619, 23864649, 24086540, 24092637, 24373324, 24529525, 24647737, 24696447, 24827430, 25191754, 25748606, 26505824, 26642437, 27322810, 27699599, 27858848, 27913104, 28004148, 28073779, 28096259, 28207876, 28342971, 28374974, 28385175, 28428027, 28674284, 28730694, 28744963, 29028177, 29138226, 29144805, 29162361, 29205117, 29330461, 29358691, 29395808, 29412810, 29412817, 29462693, 29466430, 29635505, 29671912, 29765988, 29872922, 29879463, 29941634, 30035626, 30103438, 30293770, 30417596, 30473097, 30683945, 30726969, 30765429, 31031702, 31061246, 31080438, 31299132, 31330984, 31370002, 31393567, 31443356, 31506889, 31669136, 31682875, 31689454, 31693916, 31706956, 31730763, 31741078, 31751656, 31756366, 31757794, 31759125, 31781045, 31785304, 31815785, 31838219, 8472632, 8922354, 9794107		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	30244600		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	35945262, 37582372	Associate	★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	31261732		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	28348564		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	31772610	Associate	★☆☆☆☆ Found in Text Mining only
Exocrine pancreatic insufficiency	Exocrine pancreatic insufficiency	BEFREE	29074486		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	19141695, 29549311		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	19141695, 32069846	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	19141695		★☆☆☆☆ Found in Text Mining only
Fetal Malnutrition	Poor fetal nutrition	BEFREE	9715376		★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	31169725		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	22112810		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31183364		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31183364	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31183364		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	8278382	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29733904		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	35945262	Stimulate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	29577894		★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	BEFREE	28931750		★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	28931750	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	14669159, 28452237, 28565879, 28579289, 29026101, 29138226, 30948746, 31353519, 31466128, 31572300, 31608934, 31785304		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	28271035, 29222967, 29351421, 29404215, 29406782, 31063975		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	31772610	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	18171693, 30372907, 30463644		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	18171693		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	28452237		★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	31772610	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	28235848, 31706956		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28342971, 29473979, 30282365		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	15383372, 21917634, 22237064, 23092914, 24512489	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	19332493	Stimulate	★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	22112810, 28008090		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	31198543		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	35945262	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	8278382	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	30667131, 31608934		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28552096		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	19141695	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	19141695, 32069846	Associate	★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long qt syndrome	Pubtator	29548277	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31292496		★☆☆☆☆ Found in Text Mining only
Maturity onset diabetes mellitus in young	Mason type diabetes	BEFREE	21761282		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	14607102		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	19141695	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	17624916, 28428027, 29028177		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	29360808		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	27169633, 31974732	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	35123462	Inhibit	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12099397, 22112810, 26078577, 29440684		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28342971, 29911915		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	22112810, 29440684		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	19141695, 28212710, 28552096, 31051410, 31759125		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	19141695		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	14607102, 17395281, 18171693, 19141695, 19254363, 20433877, 21106708, 22237064, 22399504, 23349498, 25324507, 26505824, 28055305, 28073779, 28271035, 28598027, 28610922, 28655715, 29406782, 29765988, 30451382, 30567927, 30726969, 30990747, 31198543, 31392745, 31443356, 31447324, 31451430, 31511854, 31539554, 31689454, 31730763, 31733230, 31751656, 31756366, 31759125, 31765668, 31812593, 31815785, 31838219		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	15383372, 18054552, 19141695, 19254363, 19332493, 21106708, 22237064, 24512489, 25324507, 29765988, 32069846, 34620218, 35945262	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	27465935	Inhibit	★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	25324507	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30121578, 30451382		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34446852	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	8472632		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	27913104, 28223210, 28366809, 28666800, 29402504, 29462693, 31705913		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	28366809		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	27181102		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	27181102, 30451975		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	29846588		★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	29846588		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	29144805		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	LHGDN	14988249		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	27169633	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29222967, 31083558, 31216011		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	31121474		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	19141695, 29549311		★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	26395740		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	26395740		★☆☆☆☆ Found in Text Mining only
Tumors of Adrenal Cortex	Tumors Of Adrenal Cortex	BEFREE	9745416		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33557879	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	31198543		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	29360808		★☆☆☆☆ Found in Text Mining only