Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	114881
Gene name	Oxysterol binding protein like 7
Gene symbol	OSBPL7
Synonyms (NCBI Gene)	ORP7
Chromosome	17
Chromosome location	17q21.32
Summary	This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, the encoded protein contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like stero

Show/Hide all (83)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002743	hsa-miR-1-3p	Microarray	15685193
MIRT002743	hsa-miR-1-3p	Microarray;Other	15685193
MIRT2059410	hsa-miR-3914	CLIP-seq
MIRT2059411	hsa-miR-3915	CLIP-seq
MIRT2059412	hsa-miR-3928	CLIP-seq
MIRT2059413	hsa-miR-4459	CLIP-seq
MIRT2059414	hsa-miR-4722-5p	CLIP-seq
MIRT2059415	hsa-miR-765	CLIP-seq
MIRT2287764	hsa-miR-1205	CLIP-seq
MIRT2287765	hsa-miR-1321	CLIP-seq
MIRT2287766	hsa-miR-28-5p	CLIP-seq
MIRT2287767	hsa-miR-3139	CLIP-seq
MIRT2287768	hsa-miR-3154	CLIP-seq
MIRT2287769	hsa-miR-3162-5p	CLIP-seq
MIRT2287770	hsa-miR-3179	CLIP-seq
MIRT2059410	hsa-miR-3914	CLIP-seq
MIRT2059411	hsa-miR-3915	CLIP-seq
MIRT2059412	hsa-miR-3928	CLIP-seq
MIRT2287771	hsa-miR-4434	CLIP-seq
MIRT2287772	hsa-miR-4436a	CLIP-seq
MIRT2059413	hsa-miR-4459	CLIP-seq
MIRT2287773	hsa-miR-4487	CLIP-seq
MIRT2287774	hsa-miR-450b-5p	CLIP-seq
MIRT2287775	hsa-miR-4516	CLIP-seq
MIRT2287776	hsa-miR-4713-3p	CLIP-seq
MIRT2059414	hsa-miR-4722-5p	CLIP-seq
MIRT2287777	hsa-miR-4739	CLIP-seq
MIRT2287778	hsa-miR-4756-5p	CLIP-seq
MIRT2287779	hsa-miR-507	CLIP-seq
MIRT2287780	hsa-miR-557	CLIP-seq
MIRT2287781	hsa-miR-665	CLIP-seq
MIRT2287782	hsa-miR-671-5p	CLIP-seq
MIRT2287783	hsa-miR-708	CLIP-seq
MIRT2059415	hsa-miR-765	CLIP-seq
MIRT2391973	hsa-miR-2276	CLIP-seq
MIRT2059410	hsa-miR-3914	CLIP-seq
MIRT2059411	hsa-miR-3915	CLIP-seq
MIRT2059412	hsa-miR-3928	CLIP-seq
MIRT2391974	hsa-miR-4327	CLIP-seq
MIRT2059413	hsa-miR-4459	CLIP-seq
MIRT2059414	hsa-miR-4722-5p	CLIP-seq
MIRT2391975	hsa-miR-4763-5p	CLIP-seq
MIRT2059415	hsa-miR-765	CLIP-seq
MIRT2455720	hsa-miR-1285	CLIP-seq
MIRT2455721	hsa-miR-1291	CLIP-seq
MIRT2455722	hsa-miR-3135b	CLIP-seq
MIRT2455723	hsa-miR-3144-5p	CLIP-seq
MIRT2455724	hsa-miR-3173-5p	CLIP-seq
MIRT2455725	hsa-miR-3187-5p	CLIP-seq
MIRT2455726	hsa-miR-3191	CLIP-seq
MIRT2455727	hsa-miR-4300	CLIP-seq
MIRT2287771	hsa-miR-4434	CLIP-seq
MIRT2287773	hsa-miR-4487	CLIP-seq
MIRT2455728	hsa-miR-4493	CLIP-seq
MIRT2287775	hsa-miR-4516	CLIP-seq
MIRT2455729	hsa-miR-4531	CLIP-seq
MIRT2455730	hsa-miR-4652-5p	CLIP-seq
MIRT2455731	hsa-miR-4667-5p	CLIP-seq
MIRT2455732	hsa-miR-4700-5p	CLIP-seq
MIRT2455733	hsa-miR-4731-5p	CLIP-seq
MIRT2455734	hsa-miR-612	CLIP-seq
MIRT2455735	hsa-miR-661	CLIP-seq
MIRT2455736	hsa-miR-920	CLIP-seq
MIRT2455720	hsa-miR-1285	CLIP-seq
MIRT2455721	hsa-miR-1291	CLIP-seq
MIRT2455722	hsa-miR-3135b	CLIP-seq
MIRT2455723	hsa-miR-3144-5p	CLIP-seq
MIRT2455724	hsa-miR-3173-5p	CLIP-seq
MIRT2455725	hsa-miR-3187-5p	CLIP-seq
MIRT2455726	hsa-miR-3191	CLIP-seq
MIRT2455727	hsa-miR-4300	CLIP-seq
MIRT2287771	hsa-miR-4434	CLIP-seq
MIRT2287773	hsa-miR-4487	CLIP-seq
MIRT2455728	hsa-miR-4493	CLIP-seq
MIRT2287775	hsa-miR-4516	CLIP-seq
MIRT2455729	hsa-miR-4531	CLIP-seq
MIRT2455730	hsa-miR-4652-5p	CLIP-seq
MIRT2455731	hsa-miR-4667-5p	CLIP-seq
MIRT2455732	hsa-miR-4700-5p	CLIP-seq
MIRT2455733	hsa-miR-4731-5p	CLIP-seq
MIRT2455734	hsa-miR-612	CLIP-seq
MIRT2455735	hsa-miR-661	CLIP-seq
MIRT2455736	hsa-miR-920	CLIP-seq

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21669198
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005776	Component	Autophagosome	IDA	21669198
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	14593528
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	14593528
GO:0005886	Component	Plasma membrane	IEA
GO:0006699	Process	Bile acid biosynthetic process	IEA
GO:0006699	Process	Bile acid biosynthetic process	TAS
GO:0006869	Process	Lipid transport	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0010506	Process	Regulation of autophagy	NAS	21669198
GO:0015485	Function	Cholesterol binding	IBA
GO:0015485	Function	Cholesterol binding	IDA	17428193
GO:0015918	Process	Sterol transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0031965	Component	Nuclear membrane	IBA
GO:0071397	Process	Cellular response to cholesterol	IMP	21669198
GO:0097038	Component	Perinuclear endoplasmic reticulum	IBA
GO:0097038	Component	Perinuclear endoplasmic reticulum	IDA	14593528
GO:0097038	Component	Perinuclear endoplasmic reticulum	IEA
GO:0120015	Function	Sterol transfer activity	IEA
GO:0120015	Function	Sterol transfer activity	TAS
GO:1901800	Process	Positive regulation of proteasomal protein catabolic process	IMP	21669198

MIM	HGNC	e!Ensembl
606735	16387	ENSG00000006025

Q9BZF2

Protein name

Oxysterol-binding protein-related protein 7 (ORP-7) (OSBP-related protein 7)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15409	PH_8	52 → 141	Pleckstrin homology domain	Domain
PF01237	Oxysterol_BP	478 → 826	Oxysterol-binding protein	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in epithelium of small and large intestines (at protein level). Expressed in stomach, duodenum, jejunum, ascending colon, spleen, thymus, lymph node, trachea and leukocytes. {ECO:0000269|PubMed:14593528}.

Sequence

MDFQERDPPFLPESAQSSKPSSAQQASELWEVVEEPRVRLGTEGVMPERQEGHLLKKRKW
PLKGWHKRYFVLEDGILHYATTRQDITKGKLHGSIDVRLSVMSINKKAQRIDLDTEDNIY
HLKIKSQDLFQSWVAQLRAHRLAHRLDMPRGSLPSTAHRKVPGAQLPTAATASALPGLGP
REKVSSWLRDSDGLDRCSHELSECQGKLQELHRLLQSLESLHRIPSAPVIPTHQASVTTE
RPKKGKRTSRMWCTQSFAKDDTIGRVGRLHGSVPNLSRYLESRDSSGTRGLPPTDYAHLQ
RSFWALAQKVHSSLSSVLAALTMERDQLRDMHQGSELSRMGVSEASTGQRRLHSLSTSSD
TTADSFSSLNPEEQEALYMKGRELTPQLSQTSILSLADSHTEFFDACEVLLSASSSENEG
SEEEESCTSEITTSLSEEMLDLRGAERCQKGGCVPGRPMGPPRRRCLPAASGPGADVSLW
NILRNNIGKDLSKVSMPVQLNEPLNTLQRLCEELEYSSLLDQASRIADPCERMVYIAAFA
VSAYSSTYHRAGCKPFNPVLGETYECERPDRGFRFISEQVSHHPPISACHAESENFAFWQ
DMKWKNKFWGKSLEIVPVGTVNVSLPRFGDHFEWNKVTSCIHNVLSGQRWIEHYGEVLIR
NTQDSSCHCKITFCKAKYWSSNVHEVQGAVLSRSGRVLHRLFGKWHEGLYRGPTPGGQCI
WKPNSMPPDHERNFGFTQFALELNELTAELKRSLPSTDTRLRPDQRYLEEGNIQAAEAQK
RRIEQLQRDRRKVMEENNIVHQARFFRRQTDSSGKEWWVTNNTYWRLRAEPGYGNMDGAV
LW

Sequence length

842

Interactions

View interactions

	Reactome
			Synthesis of bile acids and bile salts

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Encephalopathy, lethal, due to defective mitochondrial peroxisomal fission 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	21763455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	30054458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	36980993	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21763455		★★★★★ ★☆☆☆☆ Found in Text Mining only

OSBPL7 (oxysterol binding protein like 7)