Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	114836
Gene name	SLAM family member 6
Gene symbol	SLAMF6
Synonyms (NCBI Gene)	CD352KALIKALIbLy108NTB-ANTBASF2000
Chromosome	1
Chromosome location	1q23.2-q23.3
Summary	The protein encoded by this gene is a type I transmembrane protein, belonging to the CD2 subfamily of the immunoglobulin superfamily. This encoded protein is expressed on Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and

Show/Hide all (82)

miRTarBase ID	miRNA	Experiments
MIRT1351478	hsa-let-7a	CLIP-seq
MIRT1351479	hsa-let-7b	CLIP-seq
MIRT1351480	hsa-let-7c	CLIP-seq
MIRT1351481	hsa-let-7d	CLIP-seq
MIRT1351482	hsa-let-7e	CLIP-seq
MIRT1351483	hsa-let-7f	CLIP-seq
MIRT1351484	hsa-let-7g	CLIP-seq
MIRT1351485	hsa-let-7i	CLIP-seq
MIRT1351486	hsa-miR-202	CLIP-seq
MIRT1351487	hsa-miR-3927	CLIP-seq
MIRT1351488	hsa-miR-4303	CLIP-seq
MIRT1351489	hsa-miR-4451	CLIP-seq
MIRT1351490	hsa-miR-4458	CLIP-seq
MIRT1351491	hsa-miR-4500	CLIP-seq
MIRT1351492	hsa-miR-4649-3p	CLIP-seq
MIRT1351493	hsa-miR-4762-3p	CLIP-seq
MIRT1351494	hsa-miR-98	CLIP-seq
MIRT2104172	hsa-miR-1236	CLIP-seq
MIRT2104173	hsa-miR-1343	CLIP-seq
MIRT2104174	hsa-miR-1976	CLIP-seq
MIRT2104175	hsa-miR-24	CLIP-seq
MIRT2104176	hsa-miR-371-5p	CLIP-seq
MIRT2104177	hsa-miR-4279	CLIP-seq
MIRT2104178	hsa-miR-4284	CLIP-seq
MIRT2104179	hsa-miR-4722-3p	CLIP-seq
MIRT2104180	hsa-miR-498	CLIP-seq
MIRT2104173	hsa-miR-1343	CLIP-seq
MIRT2328289	hsa-miR-1915	CLIP-seq
MIRT2104174	hsa-miR-1976	CLIP-seq
MIRT2328290	hsa-miR-2861	CLIP-seq
MIRT2328291	hsa-miR-3187-3p	CLIP-seq
MIRT2328292	hsa-miR-3545-3p	CLIP-seq
MIRT2328293	hsa-miR-3663-5p	CLIP-seq
MIRT2328294	hsa-miR-4264	CLIP-seq
MIRT2104177	hsa-miR-4279	CLIP-seq
MIRT2328295	hsa-miR-4435	CLIP-seq
MIRT2328296	hsa-miR-4512	CLIP-seq
MIRT2328297	hsa-miR-4635	CLIP-seq
MIRT2328298	hsa-miR-4680-5p	CLIP-seq
MIRT2328299	hsa-miR-4701-5p	CLIP-seq
MIRT2328300	hsa-miR-4715-5p	CLIP-seq
MIRT2104179	hsa-miR-4722-3p	CLIP-seq
MIRT2328301	hsa-miR-4726-3p	CLIP-seq
MIRT2328302	hsa-miR-4755-3p	CLIP-seq
MIRT2328303	hsa-miR-4768-3p	CLIP-seq
MIRT2104180	hsa-miR-498	CLIP-seq
MIRT2328304	hsa-miR-548s	CLIP-seq
MIRT2328305	hsa-miR-588	CLIP-seq
MIRT2328306	hsa-miR-622	CLIP-seq
MIRT2328307	hsa-miR-665	CLIP-seq
MIRT2104173	hsa-miR-1343	CLIP-seq
MIRT2104174	hsa-miR-1976	CLIP-seq
MIRT2328294	hsa-miR-4264	CLIP-seq
MIRT2104177	hsa-miR-4279	CLIP-seq
MIRT2104179	hsa-miR-4722-3p	CLIP-seq
MIRT2104180	hsa-miR-498	CLIP-seq
MIRT2623076	hsa-miR-129-5p	CLIP-seq
MIRT2104173	hsa-miR-1343	CLIP-seq
MIRT2104174	hsa-miR-1976	CLIP-seq
MIRT2623077	hsa-miR-3149	CLIP-seq
MIRT2328294	hsa-miR-4264	CLIP-seq
MIRT2104177	hsa-miR-4279	CLIP-seq
MIRT2104179	hsa-miR-4722-3p	CLIP-seq
MIRT2623078	hsa-miR-4735-5p	CLIP-seq
MIRT2623079	hsa-miR-4775	CLIP-seq
MIRT2623080	hsa-miR-4794	CLIP-seq
MIRT2104180	hsa-miR-498	CLIP-seq
MIRT2623081	hsa-miR-590-3p	CLIP-seq
MIRT2328306	hsa-miR-622	CLIP-seq
MIRT2623076	hsa-miR-129-5p	CLIP-seq
MIRT2104173	hsa-miR-1343	CLIP-seq
MIRT2104174	hsa-miR-1976	CLIP-seq
MIRT2623077	hsa-miR-3149	CLIP-seq
MIRT2328294	hsa-miR-4264	CLIP-seq
MIRT2104177	hsa-miR-4279	CLIP-seq
MIRT2104179	hsa-miR-4722-3p	CLIP-seq
MIRT2623078	hsa-miR-4735-5p	CLIP-seq
MIRT2623079	hsa-miR-4775	CLIP-seq
MIRT2623080	hsa-miR-4794	CLIP-seq
MIRT2104180	hsa-miR-498	CLIP-seq
MIRT2623081	hsa-miR-590-3p	CLIP-seq
MIRT2328306	hsa-miR-622	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	11489943, 16920955, 22912825, 23346089, 24688028, 32296183
GO:0005886	Component	Plasma membrane	IDA	22184727
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IBA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0032729	Process	Positive regulation of type II interferon production	IMP	16920955
GO:0032740	Process	Positive regulation of interleukin-17 production	IDA	22184727
GO:0042110	Process	T cell activation	IBA
GO:0045087	Process	Innate immune response	IEA
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IDA	16920955
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0072540	Process	T-helper 17 cell lineage commitment	IDA	22184727

MIM	HGNC	e!Ensembl
606446	21392	ENSG00000162739

Q96DU3

Protein name

SLAM family member 6 (Activating NK receptor) (NK-T-B-antigen) (NTB-A) (CD antigen CD352)

Protein function

Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and

PDB

2IF7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	26 → 127	Immunoglobulin V-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed by all (resting and activated) natural killer cells (NK), T- and B-lymphocytes (PubMed:11489943). Increased surface expression on T-cells of systemic lupus erythematosus (SLE) patients (PubMed:22184727). {ECO:0000269|PubMed:1

Sequence

MLWLFQSLLFVFCFGPGNVVSQSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNET
SLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLS
SYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLT
VSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKMILFMVSGICIVFGF
IILLLLVLRKRRDSLSLSTQRTQGPAESARNLEYVSVSPTNNTVYASVTHSNRETEIWTP
RENDTITIYSTINHSKESKPTFSRATALDNVV

Sequence length

332

Interactions

View interactions

	Reactome
			Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (28)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Angina Pectoris	Angina pectoris	Pubtator	26823790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	32723749, 35016729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	18482989, 28635960, 31199820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	22184727	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34867821, 38287061	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37861541	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31672930	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	31315913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	35370940	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	23612905		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves Disease	GWASCAT_DG	23612905		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves Disease	GWASDB_DG	23612905		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia	Leukemia	Pubtator	15536144	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	18482989, 24508410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	21231893, 35603218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	22184727, 22989874	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	18482989, 24508410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18482989, 21231893, 22184727, 22989874, 24508410, 29020082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	18482989, 24508410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	31315913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	24688028	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19089686, 31199820, 31315913		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29305520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	38287061, 40558528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	26287276	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	26823790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18508446, 31315913		★★★★★ ★☆☆☆☆ Found in Text Mining only
X-Linked Lymphoproliferative Disorder	Lymphoproliferative Syndrome, X-Linked	BEFREE	11489943		★★★★★ ★☆☆☆☆ Found in Text Mining only

SLAMF6 (SLAM family member 6)