Gene Gene information from NCBI Gene database.
Entrez ID 114769
Gene name Caspase recruitment domain family member 16
Gene symbol CARD16
Synonyms (NCBI Gene)
COPCOP1LLID-114769PSEUDO-ICE
Chromosome 11
Chromosome location 11q22.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23
GO ID Ontology Definition Evidence Reference
GO:0004197 Function Cysteine-type endopeptidase activity IEA
GO:0004869 Function Cysteine-type endopeptidase inhibitor activity IDA 11432859, 16920334
GO:0004869 Function Cysteine-type endopeptidase inhibitor activity IEA
GO:0005515 Function Protein binding IPI 11536016, 11821383, 15383541
GO:0006508 Process Proteolysis IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
615680 33701 ENSG00000204397
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5EG05
Protein name Caspase recruitment domain-containing protein 16 (Caspase recruitment domain-only protein 1) (CARD-only protein 1) (Caspase-1 inhibitor COP) (Pseudo interleukin-1 beta converting enzyme) (Pseudo-ICE) (Pseudo-IL1B-converting enzyme)
Protein function Caspase inhibitor. Acts as a regulator of procaspase-1/CASP1 activation implicated in the regulation of the proteolytic maturation of pro-interleukin-1 beta (IL1B) and its release during inflammation. Inhibits the release of IL1B in response to
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00619 CARD 3 90 Caspase recruitment domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed at higher level in placenta, spleen, lymph node and bone marrow. Weakly or not expressed in thymus. {ECO:0000269|PubMed:11432859, ECO:0000269|PubMed:11536016}.
Sequence
MADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDS
VIPKGAQACQICITYICEEDSYLAETLGLS
AALQAVQDNPAMPTCSSPEGRIKLCFLEDA
QRIWKQKLQRCHVQNTIIKWSERYTSGSFEMQWLFLRTNFIERFWRNILLLPLHKGSLYP
RIPGLGKELQTGTHKLS
Sequence length 197
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  NOD-like receptor signaling pathway  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ASPHYXIA NEONATORUM GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BRONCHOPULMONARY DYSPLASIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Ablepharon Ablepharon BEFREE 28793888, 29727778, 29869975
★☆☆☆☆
Found in Text Mining only
Acute Coronary Syndrome Coronary Syndrome BEFREE 25747584
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 15492238, 21572435, 27278120
★☆☆☆☆
Found in Text Mining only
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis BEFREE 17597611
★☆☆☆☆
Found in Text Mining only
Anorexia Anorexia BEFREE 29061362
★☆☆☆☆
Found in Text Mining only
Autistic Disorder Autism CTD_human_DG 19404257
★☆☆☆☆
Found in Text Mining only
Autistic Disorder Autism Pubtator 19404257 Associate
★☆☆☆☆
Found in Text Mining only
Bladder Neoplasm Bladder Neoplasm BEFREE 26753957
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 15492238, 24027432, 29516369
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 24018495 Associate
★☆☆☆☆
Found in Text Mining only