Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	114757
Gene name	Cytoglobin
Gene symbol	CYGB
Synonyms (NCBI Gene)	HGBNODSTAP
Chromosome	17
Chromosome location	17q25.1
Summary	This gene encodes a globin protein found in vertebrate cells. The encoded protein is described as a hexacoordinate hemoglobin which binds ligand differently from the pentacoordinate hemoglobins involved in oxygen transport, and may be involved in protecti

219

Show/Hide all (219)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016773	hsa-miR-335-5p	Microarray	18185580
MIRT504681	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT504680	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT504679	hsa-miR-190a-5p	PAR-CLIP	21572407
MIRT504678	hsa-miR-190b	PAR-CLIP	21572407
MIRT504677	hsa-miR-567	PAR-CLIP	21572407
MIRT504676	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT504675	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT504674	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT504673	hsa-miR-3924	PAR-CLIP	21572407
MIRT504672	hsa-miR-518d-5p	PAR-CLIP	21572407
MIRT504671	hsa-miR-518e-5p	PAR-CLIP	21572407
MIRT504670	hsa-miR-518f-5p	PAR-CLIP	21572407
MIRT504669	hsa-miR-519a-5p	PAR-CLIP	21572407
MIRT504668	hsa-miR-519b-5p	PAR-CLIP	21572407
MIRT504667	hsa-miR-519c-5p	PAR-CLIP	21572407
MIRT504666	hsa-miR-520c-5p	PAR-CLIP	21572407
MIRT504665	hsa-miR-522-5p	PAR-CLIP	21572407
MIRT504664	hsa-miR-523-5p	PAR-CLIP	21572407
MIRT504663	hsa-miR-526a	PAR-CLIP	21572407
MIRT504662	hsa-miR-4777-5p	PAR-CLIP	21572407
MIRT504661	hsa-miR-297	PAR-CLIP	21572407
MIRT504660	hsa-miR-6083	PAR-CLIP	21572407
MIRT504659	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT504681	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT504680	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT504679	hsa-miR-190a-5p	PAR-CLIP	21572407
MIRT504678	hsa-miR-190b	PAR-CLIP	21572407
MIRT504677	hsa-miR-567	PAR-CLIP	21572407
MIRT504676	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT504675	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT504674	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT504673	hsa-miR-3924	PAR-CLIP	21572407
MIRT504661	hsa-miR-297	PAR-CLIP	21572407
MIRT504659	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT531154	hsa-miR-5683	PAR-CLIP	22012620
MIRT531153	hsa-miR-2392	PAR-CLIP	22012620
MIRT531152	hsa-miR-1245b-3p	PAR-CLIP	22012620
MIRT531151	hsa-miR-4699-5p	PAR-CLIP	22012620
MIRT531150	hsa-miR-1185-5p	PAR-CLIP	22012620
MIRT531149	hsa-miR-3679-5p	PAR-CLIP	22012620
MIRT531148	hsa-miR-3605-5p	PAR-CLIP	22012620
MIRT531147	hsa-miR-1255a	PAR-CLIP	22012620
MIRT531146	hsa-miR-1255b-5p	PAR-CLIP	22012620
MIRT518356	hsa-miR-7705	PAR-CLIP	23446348
MIRT504681	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT504680	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT504679	hsa-miR-190a-5p	PAR-CLIP	23446348
MIRT504678	hsa-miR-190b	PAR-CLIP	23446348
MIRT504677	hsa-miR-567	PAR-CLIP	23446348
MIRT504676	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT504675	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT504674	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT504673	hsa-miR-3924	PAR-CLIP	23446348
MIRT504672	hsa-miR-518d-5p	PAR-CLIP	23446348
MIRT504671	hsa-miR-518e-5p	PAR-CLIP	23446348
MIRT504670	hsa-miR-518f-5p	PAR-CLIP	23446348
MIRT504669	hsa-miR-519a-5p	PAR-CLIP	23446348
MIRT504668	hsa-miR-519b-5p	PAR-CLIP	23446348
MIRT504667	hsa-miR-519c-5p	PAR-CLIP	23446348
MIRT504666	hsa-miR-520c-5p	PAR-CLIP	23446348
MIRT504665	hsa-miR-522-5p	PAR-CLIP	23446348
MIRT504664	hsa-miR-523-5p	PAR-CLIP	23446348
MIRT504663	hsa-miR-526a	PAR-CLIP	23446348
MIRT504662	hsa-miR-4777-5p	PAR-CLIP	23446348
MIRT504661	hsa-miR-297	PAR-CLIP	23446348
MIRT504660	hsa-miR-6083	PAR-CLIP	23446348
MIRT504659	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT504681	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT504676	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT504675	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT504674	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT504673	hsa-miR-3924	PAR-CLIP	23446348
MIRT504659	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT504681	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT504680	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT504679	hsa-miR-190a-5p	PAR-CLIP	23446348
MIRT504678	hsa-miR-190b	PAR-CLIP	23446348
MIRT504677	hsa-miR-567	PAR-CLIP	23446348
MIRT504676	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT504675	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT504674	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT504673	hsa-miR-3924	PAR-CLIP	23446348
MIRT504672	hsa-miR-518d-5p	PAR-CLIP	23446348
MIRT504671	hsa-miR-518e-5p	PAR-CLIP	23446348
MIRT504670	hsa-miR-518f-5p	PAR-CLIP	23446348
MIRT504669	hsa-miR-519a-5p	PAR-CLIP	23446348
MIRT504668	hsa-miR-519b-5p	PAR-CLIP	23446348
MIRT504667	hsa-miR-519c-5p	PAR-CLIP	23446348
MIRT504666	hsa-miR-520c-5p	PAR-CLIP	23446348
MIRT504665	hsa-miR-522-5p	PAR-CLIP	23446348
MIRT504664	hsa-miR-523-5p	PAR-CLIP	23446348
MIRT504663	hsa-miR-526a	PAR-CLIP	23446348
MIRT504662	hsa-miR-4777-5p	PAR-CLIP	23446348
MIRT504661	hsa-miR-297	PAR-CLIP	23446348
MIRT504660	hsa-miR-6083	PAR-CLIP	23446348
MIRT504659	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT504681	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT504680	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT504679	hsa-miR-190a-5p	PAR-CLIP	21572407
MIRT504678	hsa-miR-190b	PAR-CLIP	21572407
MIRT504677	hsa-miR-567	PAR-CLIP	21572407
MIRT504676	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT504675	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT504674	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT504673	hsa-miR-3924	PAR-CLIP	21572407
MIRT504672	hsa-miR-518d-5p	PAR-CLIP	21572407
MIRT504671	hsa-miR-518e-5p	PAR-CLIP	21572407
MIRT504670	hsa-miR-518f-5p	PAR-CLIP	21572407
MIRT504669	hsa-miR-519a-5p	PAR-CLIP	21572407
MIRT504668	hsa-miR-519b-5p	PAR-CLIP	21572407
MIRT504667	hsa-miR-519c-5p	PAR-CLIP	21572407
MIRT504666	hsa-miR-520c-5p	PAR-CLIP	21572407
MIRT504665	hsa-miR-522-5p	PAR-CLIP	21572407
MIRT504664	hsa-miR-523-5p	PAR-CLIP	21572407
MIRT504663	hsa-miR-526a	PAR-CLIP	21572407
MIRT504662	hsa-miR-4777-5p	PAR-CLIP	21572407
MIRT504661	hsa-miR-297	PAR-CLIP	21572407
MIRT504660	hsa-miR-6083	PAR-CLIP	21572407
MIRT504659	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT504681	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT504680	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT504679	hsa-miR-190a-5p	PAR-CLIP	21572407
MIRT504678	hsa-miR-190b	PAR-CLIP	21572407
MIRT504677	hsa-miR-567	PAR-CLIP	21572407
MIRT504676	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT504675	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT504674	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT504673	hsa-miR-3924	PAR-CLIP	21572407
MIRT504661	hsa-miR-297	PAR-CLIP	21572407
MIRT504659	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT531154	hsa-miR-5683	PAR-CLIP	22012620
MIRT531153	hsa-miR-2392	PAR-CLIP	22012620
MIRT531152	hsa-miR-1245b-3p	PAR-CLIP	22012620
MIRT531151	hsa-miR-4699-5p	PAR-CLIP	22012620
MIRT531150	hsa-miR-1185-5p	PAR-CLIP	22012620
MIRT531149	hsa-miR-3679-5p	PAR-CLIP	22012620
MIRT531148	hsa-miR-3605-5p	PAR-CLIP	22012620
MIRT531147	hsa-miR-1255a	PAR-CLIP	22012620
MIRT531146	hsa-miR-1255b-5p	PAR-CLIP	22012620
MIRT518356	hsa-miR-7705	PAR-CLIP	23446348
MIRT504681	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT504680	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT504679	hsa-miR-190a-5p	PAR-CLIP	23446348
MIRT504678	hsa-miR-190b	PAR-CLIP	23446348
MIRT504677	hsa-miR-567	PAR-CLIP	23446348
MIRT504676	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT504675	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT504674	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT504673	hsa-miR-3924	PAR-CLIP	23446348
MIRT504672	hsa-miR-518d-5p	PAR-CLIP	23446348
MIRT504671	hsa-miR-518e-5p	PAR-CLIP	23446348
MIRT504670	hsa-miR-518f-5p	PAR-CLIP	23446348
MIRT504669	hsa-miR-519a-5p	PAR-CLIP	23446348
MIRT504668	hsa-miR-519b-5p	PAR-CLIP	23446348
MIRT504667	hsa-miR-519c-5p	PAR-CLIP	23446348
MIRT504666	hsa-miR-520c-5p	PAR-CLIP	23446348
MIRT504665	hsa-miR-522-5p	PAR-CLIP	23446348
MIRT504664	hsa-miR-523-5p	PAR-CLIP	23446348
MIRT504663	hsa-miR-526a	PAR-CLIP	23446348
MIRT504662	hsa-miR-4777-5p	PAR-CLIP	23446348
MIRT504661	hsa-miR-297	PAR-CLIP	23446348
MIRT504660	hsa-miR-6083	PAR-CLIP	23446348
MIRT504659	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT504681	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT504676	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT504675	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT504674	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT504673	hsa-miR-3924	PAR-CLIP	23446348
MIRT504659	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT504681	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT504680	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT504679	hsa-miR-190a-5p	PAR-CLIP	23446348
MIRT504678	hsa-miR-190b	PAR-CLIP	23446348
MIRT504677	hsa-miR-567	PAR-CLIP	23446348
MIRT504676	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT504675	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT504674	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT504673	hsa-miR-3924	PAR-CLIP	23446348
MIRT504672	hsa-miR-518d-5p	PAR-CLIP	23446348
MIRT504671	hsa-miR-518e-5p	PAR-CLIP	23446348
MIRT504670	hsa-miR-518f-5p	PAR-CLIP	23446348
MIRT504669	hsa-miR-519a-5p	PAR-CLIP	23446348
MIRT504668	hsa-miR-519b-5p	PAR-CLIP	23446348
MIRT504667	hsa-miR-519c-5p	PAR-CLIP	23446348
MIRT504666	hsa-miR-520c-5p	PAR-CLIP	23446348
MIRT504665	hsa-miR-522-5p	PAR-CLIP	23446348
MIRT504664	hsa-miR-523-5p	PAR-CLIP	23446348
MIRT504663	hsa-miR-526a	PAR-CLIP	23446348
MIRT504662	hsa-miR-4777-5p	PAR-CLIP	23446348
MIRT504661	hsa-miR-297	PAR-CLIP	23446348
MIRT504660	hsa-miR-6083	PAR-CLIP	23446348
MIRT504659	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT920206	hsa-miR-1913	CLIP-seq
MIRT920207	hsa-miR-210	CLIP-seq
MIRT920208	hsa-miR-3194-3p	CLIP-seq
MIRT920209	hsa-miR-324-3p	CLIP-seq
MIRT920210	hsa-miR-4707-3p	CLIP-seq
MIRT920211	hsa-miR-4731-5p	CLIP-seq
MIRT920212	hsa-miR-615-5p	CLIP-seq
MIRT920206	hsa-miR-1913	CLIP-seq
MIRT920209	hsa-miR-324-3p	CLIP-seq
MIRT1972715	hsa-miR-4749-3p	CLIP-seq
MIRT2208409	hsa-miR-214	CLIP-seq
MIRT2208410	hsa-miR-3619-5p	CLIP-seq
MIRT2208411	hsa-miR-4722-5p	CLIP-seq
MIRT2208412	hsa-miR-4779	CLIP-seq
MIRT2208413	hsa-miR-761	CLIP-seq
MIRT2386631	hsa-miR-425	CLIP-seq
MIRT2386632	hsa-miR-642b	CLIP-seq
MIRT2512242	hsa-miR-342-5p	CLIP-seq
MIRT2512243	hsa-miR-3918	CLIP-seq
MIRT2512244	hsa-miR-4459	CLIP-seq
MIRT2512245	hsa-miR-4651	CLIP-seq
MIRT2512246	hsa-miR-4664-5p	CLIP-seq
MIRT2208412	hsa-miR-4779	CLIP-seq
MIRT2512247	hsa-miR-608	CLIP-seq
MIRT2512248	hsa-miR-665	CLIP-seq
MIRT2512249	hsa-miR-765	CLIP-seq

Show/Hide all (46)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0004096	Function	Catalase activity	IEA
GO:0004601	Function	Peroxidase activity	IEA
GO:0004601	Function	Peroxidase activity	ISS	11320098
GO:0004784	Function	Superoxide dismutase activity	IDA	34930834
GO:0004784	Function	Superoxide dismutase activity	IEA
GO:0005344	Function	Oxygen carrier activity	NAS	11919282
GO:0005506	Function	Iron ion binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 28536627, 32296183
GO:0005634	Component	Nucleus	IDA	14660570
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	34930834
GO:0005737	Component	Cytoplasm	IDA	14660570
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006979	Process	Response to oxidative stress	IEA
GO:0006979	Process	Response to oxidative stress	ISS	11320098
GO:0010764	Process	Negative regulation of fibroblast migration	IEA
GO:0015671	Process	Oxygen transport	IEA
GO:0015671	Process	Oxygen transport	NAS	11919282
GO:0016209	Function	Antioxidant activity	IEA
GO:0016491	Function	Oxidoreductase activity	IBA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0019395	Process	Fatty acid oxidation	IEA
GO:0019430	Process	Removal of superoxide radicals	IDA	34930834
GO:0019430	Process	Removal of superoxide radicals	IEA
GO:0019825	Function	Oxygen binding	IDA	11893755
GO:0019825	Function	Oxygen binding	IEA
GO:0020037	Function	Heme binding	IBA
GO:0020037	Function	Heme binding	IEA
GO:0032966	Process	Negative regulation of collagen biosynthetic process	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0046209	Process	Nitric oxide metabolic process	TAS
GO:0046210	Process	Nitric oxide catabolic process	IDA	28671819
GO:0046210	Process	Nitric oxide catabolic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0047888	Function	Fatty acid peroxidase activity	IEA
GO:0070025	Function	Carbon monoxide binding	IDA	11893755
GO:0098809	Function	Nitrite reductase activity	IDA	29128400
GO:0141118	Function	Nitric oxide dioxygenase activity, heme protein as donor	EXP	20511233
GO:0141118	Function	Nitric oxide dioxygenase activity, heme protein as donor	IDA	20511233, 28393874, 28671819
GO:0141118	Function	Nitric oxide dioxygenase activity, heme protein as donor	IEA
GO:2000490	Process	Negative regulation of hepatic stellate cell activation	IEA

MIM	HGNC	e!Ensembl
608759	16505	ENSG00000161544

Q8WWM9

Protein name

Cytoglobin (Histoglobin) (HGb) (Nitric oxygen dioxygenase CYGB) (NOD) (EC 1.14.12.-) (Nitrite reductase CYGB) (EC 1.7.-.-) (Pseudoperoxidase CYGB) (EC 1.11.1.-) (Stellate cell activation-associated protein) (Superoxide dismutase CYGB) (EC 1.15.1.1)

Protein function

Probable multifunctional globin with a hexacoordinated heme iron required for the catalysis of various reactions depending on redox condition of the cell as well as oxygen availability (PubMed:11893755, PubMed:12359339, PubMed:15165856, PubMed:1

PDB

1UMO , 1URV , 1URY , 1UT0 , 1UX9 , 1V5H , 2DC3 , 3AG0 , 4B3W

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00042	Globin	23 → 132	Globin	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Highest expression in heart, stomach, bladder and small intestine. {ECO:0000269|PubMed:11893755, ECO:0000269|PubMed:11919282, ECO:0000269|PubMed:14660570}.

Sequence

MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYF
SQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVE
PVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATT
PPATLPSSGP

Sequence length

190

Interactions

View interactions

	Reactome
			eNOS activation Intracellular oxygen transport

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BILIARY CIRRHOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS, EXTRAHEPATIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATIC INSUFFICIENCY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, BILIARY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CHOLANGITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINITIS PIGMENTOSA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINITIS PIGMENTOSA 36	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (85)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	27431913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	20958924, 23591990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	22025306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	22461647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	28798140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	30453003, 30906778, 30930360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	27124741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28954528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28954528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	27431913	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	CTD_human_DG	30026087		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary Cirrhosis, Primary, 1	Biliary cirrhosis	CTD_human_DG	30026087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	20958924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18794132, 20958924, 26096935, 30545372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18373244, 18794132, 25774687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18794132, 23591990, 26096935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22344671, 24737588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28393874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	28157235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis, Extrahepatic	Cholestasis	CTD_human_DG	30026087		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	BEFREE	29720595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33611811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	18691024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	18691024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	32330605	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	18691024, 21818635, 30552362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	30992080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	30992080	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	20958924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	20958924, 24379112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21631290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23688241	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	19568272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	19568272, 21063414	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	38016326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Malignant Neoplasm	Hereditary cancer	BEFREE	19568272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heredodegenerative Disorders, Nervous System	Heredodegenerative Disorders, Nervous System	CTD_human_DG	16825958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	BEFREE	16698880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28393874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19568272	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	34035373	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoderma Palmoplantar Epidermolytic	Epidermolytic palmoplantar keratoderma	Pubtator	22359545	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoderma, Palmoplantar, Diffuse	Palmoplantar keratoderma	BEFREE	16698880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29534101, 30365183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	29852187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	32330605	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	16698880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	18794132	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	20958924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	19568272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18794132, 20958924, 26096935, 30545372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30365183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18794132, 23591990, 26096935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22344671, 24737588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21796653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16449996, 18691024, 18794132, 19568272, 20958924, 21063414, 21796653, 23591990, 24816917, 26339645, 27637274, 28620820, 28916723, 30545372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24722418, 34035373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	16449996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	28883470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	28883470	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16449996, 16698880, 18794132, 19568272, 20958924, 21463610, 21631290, 22025306, 22344671, 23591990, 24737588, 24816917, 26339645, 28258342, 28620820, 30365183, 30450577, 30545372 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17532579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	27637274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16698880, 23591990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29927026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	34922489	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22344671, 24737588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24737588	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
PALMOPLANTAR KERATODERMA, NONEPIDERMOLYTIC	Nonepidermolytic palmoplantar keratoderma	BEFREE	16698880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30416314	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	CTD_human_DG	30026087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21796653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21796653	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28099346, 29503620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	30402491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	31634437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINITIS PIGMENTOSA 36	Retinitis Pigmentosa	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Secondary Biliary Cholangitis	Biliary Cholangitis	CTD_human_DG	30026087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	16449996, 19568272, 33441751, 35397613	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	19568272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	8980255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	26917989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30450577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29720595		★★★★★ ★☆☆☆☆ Found in Text Mining only

CYGB (cytoglobin)