Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	114571
Gene name	Solute carrier family 22 member 9
Gene symbol	SLC22A9
Synonyms (NCBI Gene)	HOAT4OAT4OAT7UST3Hust3
Chromosome	11
Chromosome location	11q12.3

Show/Hide all (91)

miRTarBase ID	miRNA	Experiments	Reference
MIRT622258	hsa-miR-5584-3p	HITS-CLIP	23824327
MIRT622257	hsa-miR-4277	HITS-CLIP	23824327
MIRT622256	hsa-miR-3925-3p	HITS-CLIP	23824327
MIRT622255	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT622254	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT622253	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT622252	hsa-miR-6882-3p	HITS-CLIP	23824327
MIRT622251	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT622250	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT622249	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT622248	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT622258	hsa-miR-5584-3p	HITS-CLIP	23824327
MIRT622257	hsa-miR-4277	HITS-CLIP	23824327
MIRT622256	hsa-miR-3925-3p	HITS-CLIP	23824327
MIRT622255	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT622254	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT622253	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT622252	hsa-miR-6882-3p	HITS-CLIP	23824327
MIRT622251	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT622250	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT622249	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT622248	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT2104950	hsa-miR-1	CLIP-seq
MIRT2104951	hsa-miR-1226	CLIP-seq
MIRT2104952	hsa-miR-1297	CLIP-seq
MIRT2104953	hsa-miR-1343	CLIP-seq
MIRT2104954	hsa-miR-150	CLIP-seq
MIRT2104955	hsa-miR-18a	CLIP-seq
MIRT2104956	hsa-miR-18b	CLIP-seq
MIRT2104957	hsa-miR-1913	CLIP-seq
MIRT2104958	hsa-miR-1976	CLIP-seq
MIRT2104959	hsa-miR-206	CLIP-seq
MIRT2104960	hsa-miR-26a	CLIP-seq
MIRT2104961	hsa-miR-26b	CLIP-seq
MIRT2104962	hsa-miR-3136-3p	CLIP-seq
MIRT2104963	hsa-miR-324-3p	CLIP-seq
MIRT2104964	hsa-miR-3652	CLIP-seq
MIRT2104965	hsa-miR-3673	CLIP-seq
MIRT2104966	hsa-miR-3677-5p	CLIP-seq
MIRT2104967	hsa-miR-3692	CLIP-seq
MIRT2104968	hsa-miR-4279	CLIP-seq
MIRT2104969	hsa-miR-4430	CLIP-seq
MIRT2104970	hsa-miR-4438	CLIP-seq
MIRT2104971	hsa-miR-4465	CLIP-seq
MIRT2104972	hsa-miR-4707-3p	CLIP-seq
MIRT2104973	hsa-miR-4722-3p	CLIP-seq
MIRT2104974	hsa-miR-4731-5p	CLIP-seq
MIRT2104975	hsa-miR-4733-3p	CLIP-seq
MIRT2104976	hsa-miR-4735-3p	CLIP-seq
MIRT2104977	hsa-miR-4761-5p	CLIP-seq
MIRT2104978	hsa-miR-5095	CLIP-seq
MIRT2104979	hsa-miR-562	CLIP-seq
MIRT2104980	hsa-miR-613	CLIP-seq
MIRT2104981	hsa-miR-663b	CLIP-seq
MIRT2104950	hsa-miR-1	CLIP-seq
MIRT2104951	hsa-miR-1226	CLIP-seq
MIRT2104954	hsa-miR-150	CLIP-seq
MIRT2104955	hsa-miR-18a	CLIP-seq
MIRT2104956	hsa-miR-18b	CLIP-seq
MIRT2104957	hsa-miR-1913	CLIP-seq
MIRT2104958	hsa-miR-1976	CLIP-seq
MIRT2104959	hsa-miR-206	CLIP-seq
MIRT2104962	hsa-miR-3136-3p	CLIP-seq
MIRT2104963	hsa-miR-324-3p	CLIP-seq
MIRT2104964	hsa-miR-3652	CLIP-seq
MIRT2104965	hsa-miR-3673	CLIP-seq
MIRT2104966	hsa-miR-3677-5p	CLIP-seq
MIRT2104967	hsa-miR-3692	CLIP-seq
MIRT2104968	hsa-miR-4279	CLIP-seq
MIRT2104969	hsa-miR-4430	CLIP-seq
MIRT2104970	hsa-miR-4438	CLIP-seq
MIRT2104972	hsa-miR-4707-3p	CLIP-seq
MIRT2104973	hsa-miR-4722-3p	CLIP-seq
MIRT2104974	hsa-miR-4731-5p	CLIP-seq
MIRT2104975	hsa-miR-4733-3p	CLIP-seq
MIRT2104976	hsa-miR-4735-3p	CLIP-seq
MIRT2104977	hsa-miR-4761-5p	CLIP-seq
MIRT2104978	hsa-miR-5095	CLIP-seq
MIRT2104980	hsa-miR-613	CLIP-seq
MIRT2104981	hsa-miR-663b	CLIP-seq
MIRT2104950	hsa-miR-1	CLIP-seq
MIRT2104951	hsa-miR-1226	CLIP-seq
MIRT2104959	hsa-miR-206	CLIP-seq
MIRT2104962	hsa-miR-3136-3p	CLIP-seq
MIRT2104964	hsa-miR-3652	CLIP-seq
MIRT2104965	hsa-miR-3673	CLIP-seq
MIRT2104966	hsa-miR-3677-5p	CLIP-seq
MIRT2104969	hsa-miR-4430	CLIP-seq
MIRT2104975	hsa-miR-4733-3p	CLIP-seq
MIRT2104980	hsa-miR-613	CLIP-seq
MIRT2104981	hsa-miR-663b	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
HNF1A	Activation	20829431

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005886	Component	Plasma membrane	IEA
GO:0006869	Process	Lipid transport	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	IDA	17393504
GO:0009914	Process	Hormone transport	IDA	17393504
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	IDA	17393504
GO:0015636	Function	Short-chain fatty acid transmembrane transporter activity	IDA	17393504
GO:0015711	Process	Organic anion transport	IBA
GO:0015913	Process	Short-chain fatty acid transmembrane transport	IDA	17393504
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	17393504
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0043252	Process	Sodium-independent organic anion transport	IDA	17393504
GO:0055085	Process	Transmembrane transport	IEA

MIM	HGNC	e!Ensembl
607579	16261	ENSG00000149742

Q8IVM8

Protein name

Organic anion transporter 7 (OAT7) (Organic anion/short-chain fatty acid exchanger) (Solute carrier family 22 member 9)

Protein function

Sodium-independent organic anion transporter, exhibits high specificity for sulfated conjugates of xenobiotics and steroid hormones such as estrone 3-sulfate (E1S) and dehydroepiandrosterone sulfate (DHEAS) (PubMed:17393504, PubMed:26239079, Pub

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07690	MFS_1	116 → 485	Major Facilitator Superfamily	Family

Tissue specificity

TISSUE SPECIFICITY: Specifically expressed in liver (also at protein level). {ECO:0000269|PubMed:11327718, ECO:0000269|PubMed:17393504, ECO:0000269|PubMed:26239079}.

Sequence

MAFQDLLGHAGDLWRFQILQTVFLSIFAVATYLHFMLENFTAFIPGHRCWVHILDNDTVS
DNDTGALSQDALLRISIPLDSNMRPEKCRRFVHPQWQLLHLNGTFPNTSDADMEPCVDGW
VYDRISFSSTIVTEWDLVCDSQSLTSVAKFVFMAGMMVGGILGGHLSDRFGRRFVLRWCY
LQVAIVGTCAALAPTFLIYCSLRFLSGIAAMSLITNTIMLIAEWATHRFQAMGITLGMCP
SGIAFMTLAGLAFAIRDWHILQLVVSVPYFVIFLTSSWLLESARWLIINNKPEEGLKELR
KAAHRSGMKNARDTLTLEILKSTMKKELEAAQKKKPSLCEMLHMPNICKRISLLSFTRFA
NFMAYFGLNLHVQHLGNNVFLLQTLFGAVILLANCVAPWALKYMNRRASQMLLMFLLAIC
LLAIIFVPQEMQTLREVLATLGLGASALANTLAFAHGNEVIPTIIRARAMGINATFANIA
GALAPLMMILSVYSPPLPWIIYGVFPFISGFAFLLLPETRNKPLFDTIQDEKNERKDPRE
PKQEDPRVEVTQF

Sequence length

553

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CONSTITUTIONAL MISMATCH REPAIR DEFICIENCY SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYNCH SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MISMATCH REPAIR CANCER SYNDROME 1	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34599518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	35264217	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC22A9 (solute carrier family 22 member 9)