CCDC201 (coiled-coil domain containing 201)

Gene Gene information from NCBI Gene database.
Gene Other IDs Protein Associated diseases
Entrez ID 114515518
Gene name Coiled-coil domain containing 201
Gene symbol CCDC201
Synonyms (NCBI Gene)
-
Chromosome 7
Chromosome location 7p12.3
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
621299 54081 ENSG00000283247
Protein Protein information from UniProt database.
Gene Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A1B0GTI1
Protein name Coiled-coil domain-containing protein 201
Family and domains
Sequence 
MEPGVQDLGLSSSEDESPSLAIRSPTLRKPLKHSTPEEAALGWSPRPSGGASYLSGSPMP
AHFSQDLASHPAGVSPPATVRKRRLSTLWASKESSLDLSAPGEEPPTSASLTQRQRQRQQ
QQQQQESLRAKSWAQNPGLPGILNTTGRKRRDPKKRAAAMERVRQWEIYVLQNIEEATQH
ELTIEDD
Sequence length 187
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene Other IDs Protein Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
RHEUMATOID ARTHRITIS — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (1)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Stickler syndrome type 1 Stickler syndrome Pubtator 39192094 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only