TXNRD3 (thioredoxin reductase 3)

Gene

• Entrez ID: 114112
• Gene name: Thioredoxin reductase 3
• Gene symbol: TXNRD3
• Synonyms (NCBI Gene): TGR, TR2, TR2IT1, TRXR3, TXNR3, TXNRD3IT1, TXNRD3NB, TXNRD3NT1
• Chromosome: 3
• Chromosome location: 3q21.3
• Summary: The protein encoded by this gene belongs to the pyridine nucleotide-disulfide oxidoreductase family, and is a member of the thioredoxin (Trx) system. Three thioredoxin reductase (TrxR) isozymes are found in mammals. TrxRs are selenocysteine-containing fla

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1465599	hsa-miR-3617	CLIP-seq
MIRT1465600	hsa-miR-595	CLIP-seq
MIRT1465601	hsa-miR-641	CLIP-seq
MIRT2139954	hsa-miR-200b	CLIP-seq
MIRT2139955	hsa-miR-200c	CLIP-seq
MIRT2139956	hsa-miR-369-3p	CLIP-seq
MIRT2139957	hsa-miR-429	CLIP-seq
MIRT2139958	hsa-miR-4477a	CLIP-seq
MIRT2360628	hsa-miR-3065-5p	CLIP-seq
MIRT2360629	hsa-miR-330-3p	CLIP-seq
MIRT2360630	hsa-miR-548ac	CLIP-seq
MIRT2360631	hsa-miR-548ae	CLIP-seq
MIRT2360632	hsa-miR-548aj	CLIP-seq
MIRT2360633	hsa-miR-548am	CLIP-seq
MIRT2360634	hsa-miR-548d-3p	CLIP-seq
MIRT2360635	hsa-miR-548x	CLIP-seq
MIRT2360636	hsa-miR-548z	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004791	Function	Thioredoxin-disulfide reductase (NADPH) activity	IBA
GO:0004791	Function	Thioredoxin-disulfide reductase (NADPH) activity	IEA
GO:0004791	Function	Thioredoxin-disulfide reductase (NADPH) activity	NAS	10455115
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IBA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0007283	Process	Spermatogenesis	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016668	Function	Oxidoreductase activity, acting on a sulfur group of donors, NAD(P) as acceptor	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0045454	Process	Cell redox homeostasis	IBA
GO:0045454	Process	Cell redox homeostasis	IEA
GO:0045454	Process	Cell redox homeostasis	NAS	10455115
GO:0050660	Function	Flavin adenine dinucleotide binding	IEA
GO:0098869	Process	Cellular oxidant detoxification	IEA

Other IDs

• MIM: 606235
• HGNC: 20667
• e!Ensembl: ENSG00000197763

Protein

• UniProt ID: Q86VQ6
• Protein name: Thioredoxin reductase 3 (EC 1.8.1.9) (Thioredoxin and glutathione reductase) (Thioredoxin reductase 3 intronic transcript 1) (Thioredoxin reductase 3 neighbor gene) (Thioredoxin reductase TR2)
• Protein function: Displays thioredoxin reductase, glutaredoxin and glutathione reductase activities. Catalyzes disulfide bond isomerization. Promotes disulfide bond formation between GPX4 and various sperm proteins and may play a role in sperm maturation by promo
• PDB: 3H8Q
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00462	Glutaredoxin	68 → 130	Glutaredoxin	Domain
  PF07992	Pyr_redox_2	157 → 494	Pyridine nucleotide-disulphide oxidoreductase	Domain
  PF02852	Pyr_redox_dim	514 → 627	Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain	Domain

• Sequence:

  MERSPPQSPGPGKAGDAPNRRSGHVRGARVLSPPGRRARLSSPGPSRSSEAREELRRHLV
  GLIERSRVVIFSKSYCPHSTRVKELFSSLGVECNVLELDQVDDGARVQEVLSEITNQKTV
  PNIFVNKVHVGGCDQTFQAYQSGLLQKLLQEDLAYDYDLIIIGGGSGGLSCAKEAAILGK
  KVMVLDFVVPSPQGTSWGLGGTCVNVGCIPKKLMHQAALLGQALCDSRKFGWEYNQQVRH
  NWETMTKAIQNHISSLNWGYRLSLREKAVAYVNSYGEFVEHHKIKATNKKGQETYYTAAQ
  FVIATGERPRYLGIQGDKEYCITSDDLFSLPYCPGKTLVVGASYVALECAGFLAGFGLDV
  TVMVRSILLRGFDQEMAEKVGSYMEQHGVKFLRKFIPVMVQQLEKGSPGKLKVLAKSTEG
  TETIEGVYNTVLLAIGRDSCTRKIGLEKIGVKINEKSGKIPVNDVEQTNVPYVYAVGDIL
  EDKPELTPVAIQSGKLLAQRLFGASLEKCDYINVPTTVFTPLEYGCCGLSEEKAIEVYKK
  ENLEIYHTLFWPLEWTVAGRENNTCYAKIICNKFDHDRVIGFHILGPNAGEVTQGFAAAM
  KCGLTKQLLDDTIGIHPTCGEVFTTLEITKSSGLDITQKGCUG

• Sequence length: 643

Pathways

KEGG:

Selenocompound metabolism
Pathways in cancer
Hepatocellular carcinoma

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Aarskog syndrome	Aarskog Syndrome	BEFREE	28450305		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	28377480		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	28377480		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30069364		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	23762225		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	9717050		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30069364		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22615972		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28475616		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12206992		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12206992		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	25703281		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	12206992		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31406138		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	17726104		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28475616		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	26873967, 28353076, 30054426, 31629566, 31786987, 31790054, 7699997		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	29685981		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	12100034	Associate	★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	11518854		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29150921		★☆☆☆☆ Found in Text Mining only
Malignant Hypertension	Malignant Hypertension	BEFREE	20724906, 9797175		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23762225		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	17022964, 25703281		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31406138		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29430615		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	16805794, 16824773		★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	BEFREE	31406138		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23762225		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	15674732		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	22615972		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15340358		★☆☆☆☆ Found in Text Mining only