Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	114088
Gene name	Tripartite motif containing 9
Gene symbol	TRIM9
Synonyms (NCBI Gene)	RNF91SPRING
Chromosome	14
Chromosome location	14q22.1
Summary	The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Its f

127

Show/Hide all (127)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017814	hsa-miR-335-5p	Microarray	18185580
MIRT023786	hsa-miR-1-3p	Microarray	18668037
MIRT1456166	hsa-miR-1200	CLIP-seq
MIRT1456167	hsa-miR-1303	CLIP-seq
MIRT1456168	hsa-miR-3129-3p	CLIP-seq
MIRT1456169	hsa-miR-4251	CLIP-seq
MIRT1456170	hsa-miR-4324	CLIP-seq
MIRT1456171	hsa-miR-4711-3p	CLIP-seq
MIRT1456172	hsa-miR-544b	CLIP-seq
MIRT1456173	hsa-miR-549	CLIP-seq
MIRT1456174	hsa-miR-580	CLIP-seq
MIRT1456175	hsa-miR-590-3p	CLIP-seq
MIRT1456176	hsa-miR-1	CLIP-seq
MIRT1456177	hsa-miR-1202	CLIP-seq
MIRT1456178	hsa-miR-206	CLIP-seq
MIRT1456179	hsa-miR-299-3p	CLIP-seq
MIRT1456180	hsa-miR-3148	CLIP-seq
MIRT1456181	hsa-miR-3168	CLIP-seq
MIRT1456182	hsa-miR-3170	CLIP-seq
MIRT1456183	hsa-miR-3194-5p	CLIP-seq
MIRT1456184	hsa-miR-34a	CLIP-seq
MIRT1456185	hsa-miR-34c-5p	CLIP-seq
MIRT1456186	hsa-miR-3591-3p	CLIP-seq
MIRT1456187	hsa-miR-3972	CLIP-seq
MIRT1456188	hsa-miR-409-5p	CLIP-seq
MIRT1456189	hsa-miR-4265	CLIP-seq
MIRT1456190	hsa-miR-4296	CLIP-seq
MIRT1456191	hsa-miR-4322	CLIP-seq
MIRT1456192	hsa-miR-4417	CLIP-seq
MIRT1456193	hsa-miR-449a	CLIP-seq
MIRT1456194	hsa-miR-449b	CLIP-seq
MIRT1456195	hsa-miR-4691-3p	CLIP-seq
MIRT1456196	hsa-miR-4777-3p	CLIP-seq
MIRT1456197	hsa-miR-541	CLIP-seq
MIRT1456198	hsa-miR-613	CLIP-seq
MIRT1456199	hsa-miR-654-5p	CLIP-seq
MIRT1456200	hsa-miR-665	CLIP-seq
MIRT1456201	hsa-miR-873	CLIP-seq
MIRT1923031	hsa-miR-1976	CLIP-seq
MIRT1923032	hsa-miR-4279	CLIP-seq
MIRT1923033	hsa-miR-4524	CLIP-seq
MIRT1923034	hsa-miR-4690-5p	CLIP-seq
MIRT1923035	hsa-miR-4722-5p	CLIP-seq
MIRT1923036	hsa-miR-4768-3p	CLIP-seq
MIRT2136743	hsa-miR-125a-5p	CLIP-seq
MIRT2136744	hsa-miR-125b	CLIP-seq
MIRT2136745	hsa-miR-18a	CLIP-seq
MIRT2136746	hsa-miR-18b	CLIP-seq
MIRT2136747	hsa-miR-3126-3p	CLIP-seq
MIRT2136748	hsa-miR-3176	CLIP-seq
MIRT2136749	hsa-miR-3187-3p	CLIP-seq
MIRT2136750	hsa-miR-329	CLIP-seq
MIRT2136751	hsa-miR-362-3p	CLIP-seq
MIRT2136752	hsa-miR-3662	CLIP-seq
MIRT2136753	hsa-miR-3922-3p	CLIP-seq
MIRT2136754	hsa-miR-3941	CLIP-seq
MIRT2136755	hsa-miR-4300	CLIP-seq
MIRT2136756	hsa-miR-4319	CLIP-seq
MIRT1456170	hsa-miR-4324	CLIP-seq
MIRT2136757	hsa-miR-4434	CLIP-seq
MIRT2136758	hsa-miR-4516	CLIP-seq
MIRT2136759	hsa-miR-4529-5p	CLIP-seq
MIRT2136760	hsa-miR-4531	CLIP-seq
MIRT2136761	hsa-miR-4732-3p	CLIP-seq
MIRT2136762	hsa-miR-4735-3p	CLIP-seq
MIRT2136763	hsa-miR-511	CLIP-seq
MIRT2136764	hsa-miR-518d-5p	CLIP-seq
MIRT2136765	hsa-miR-519b-5p	CLIP-seq
MIRT2136766	hsa-miR-519c-5p	CLIP-seq
MIRT2136767	hsa-miR-520c-5p	CLIP-seq
MIRT2136768	hsa-miR-526a	CLIP-seq
MIRT2136769	hsa-miR-596	CLIP-seq
MIRT2136770	hsa-miR-603	CLIP-seq
MIRT2136771	hsa-miR-670	CLIP-seq
MIRT2136772	hsa-miR-920	CLIP-seq
MIRT2357525	hsa-miR-1184	CLIP-seq
MIRT2357526	hsa-miR-1208	CLIP-seq
MIRT2136743	hsa-miR-125a-5p	CLIP-seq
MIRT2136744	hsa-miR-125b	CLIP-seq
MIRT2357527	hsa-miR-1292	CLIP-seq
MIRT2357528	hsa-miR-134	CLIP-seq
MIRT2136745	hsa-miR-18a	CLIP-seq
MIRT2136746	hsa-miR-18b	CLIP-seq
MIRT2357529	hsa-miR-2909	CLIP-seq
MIRT2357530	hsa-miR-3118	CLIP-seq
MIRT2357531	hsa-miR-3145-5p	CLIP-seq
MIRT2136752	hsa-miR-3662	CLIP-seq
MIRT2357532	hsa-miR-431	CLIP-seq
MIRT2136756	hsa-miR-4319	CLIP-seq
MIRT1456170	hsa-miR-4324	CLIP-seq
MIRT2357533	hsa-miR-4471	CLIP-seq
MIRT1456171	hsa-miR-4711-3p	CLIP-seq
MIRT2136761	hsa-miR-4732-3p	CLIP-seq
MIRT2136762	hsa-miR-4735-3p	CLIP-seq
MIRT2357534	hsa-miR-4778-3p	CLIP-seq
MIRT2357535	hsa-miR-499-3p	CLIP-seq
MIRT2357536	hsa-miR-499a-3p	CLIP-seq
MIRT2357537	hsa-miR-508-5p	CLIP-seq
MIRT2357538	hsa-miR-550b	CLIP-seq
MIRT2357539	hsa-miR-579	CLIP-seq
MIRT2136771	hsa-miR-670	CLIP-seq
MIRT2396379	hsa-miR-4275	CLIP-seq
MIRT2396380	hsa-miR-513c	CLIP-seq
MIRT2396381	hsa-miR-514b-5p	CLIP-seq
MIRT2357526	hsa-miR-1208	CLIP-seq
MIRT2357527	hsa-miR-1292	CLIP-seq
MIRT2357531	hsa-miR-3145-5p	CLIP-seq
MIRT2357533	hsa-miR-4471	CLIP-seq
MIRT2357537	hsa-miR-508-5p	CLIP-seq
MIRT2651251	hsa-miR-181a	CLIP-seq
MIRT2651252	hsa-miR-181b	CLIP-seq
MIRT2651253	hsa-miR-181c	CLIP-seq
MIRT2651254	hsa-miR-181d	CLIP-seq
MIRT2651255	hsa-miR-361-3p	CLIP-seq
MIRT2136752	hsa-miR-3662	CLIP-seq
MIRT2651256	hsa-miR-4262	CLIP-seq
MIRT2651257	hsa-miR-4277	CLIP-seq
MIRT2651258	hsa-miR-4677-3p	CLIP-seq
MIRT2651259	hsa-miR-4679	CLIP-seq
MIRT2651260	hsa-miR-4704-3p	CLIP-seq
MIRT2651261	hsa-miR-485-3p	CLIP-seq
MIRT2651262	hsa-miR-494	CLIP-seq
MIRT2651255	hsa-miR-361-3p	CLIP-seq
MIRT2136752	hsa-miR-3662	CLIP-seq
MIRT2651257	hsa-miR-4277	CLIP-seq
MIRT2651258	hsa-miR-4677-3p	CLIP-seq
MIRT2651259	hsa-miR-4679	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 26871637, 31515488, 32296183, 32814053, 33961781, 36931259
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	11331580, 20085810
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0008021	Component	Synaptic vesicle	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019904	Function	Protein domain specific binding	IPI	22084112
GO:0030425	Component	Dendrite	IDA	20085810
GO:0030425	Component	Dendrite	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	11331580
GO:0042995	Component	Cell projection	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	20085810
GO:0045202	Component	Synapse	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	20085810
GO:0061630	Function	Ubiquitin protein ligase activity	IEA

MIM	HGNC	e!Ensembl
606555	16288	ENSG00000100505

Q9C026

Protein name

E3 ubiquitin-protein ligase TRIM9 (EC 2.3.2.27) (RING finger protein 91) (RING-type E3 ubiquitin transferase TRIM9) (Tripartite motif-containing protein 9)

Protein function

E3 ubiquitin-protein ligase which ubiquitinates itself in cooperation with an E2 enzyme UBE2D2/UBC4 and serves as a targeting signal for proteasomal degradation. May play a role in regulation of neuronal functions and may also participate in the

PDB

2DB8 , 7B2S

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13920	zf-C3HC4_3	6 → 44		Domain
PF00643	zf-B_box	224 → 266	B-box zinc finger	Domain
PF00041	fn3	441 → 525	Fibronectin type III domain	Domain
PF00622	SPRY	578 → 698	SPRY domain	Family

Tissue specificity

TISSUE SPECIFICITY: Brain. Highly expressed in the cerebral cortex (at protein level). Severely decreased in the affected brain areas in Parkinson disease and dementia with Lewy bodies. {ECO:0000269|PubMed:20085810}.

Sequence

MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDY
DYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPV
PRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATV
MCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMY
CVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRN
MVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKL
RQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMTTDFDLSLDNS
PLLQSIHQLDFVQVKASSPVPATPILQLEECCTHNNSATLSWKQPPLSTVPADGYILELD
DGNGGQFREVYVGKETMCTVDGLHFNSTYNARVKAFNKTGVSPYSKTLVLQTSEVAWFAF
DPGSAHSDIILSNDNLTVTCSSYDDRVVLGKTGFSKGIHYWELTVDRYDNHPDPAFGVAR
MDVMKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEGGITKGATIGVLLDLNRKNLTF
FINDEQQGPIAFDNVEGLFFPAVSLNRNVQVTLHTGLPVPDFYSSRASIA

Sequence length

710

Interactions

View interactions

	Reactome
			Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (20)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Autistic Disorder	Autism	Pubtator	24651380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	30020148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	24651380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37124931	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16007190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	37124931	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29669288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29669288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	24651380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30970257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	20085810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	30703767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	GWASDB_DG	19629137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26599082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Other and unspecified reactive psychosis	Reactive Psychosis	GWASCAT_DG	24132900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	20085810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	30350014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34646089	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	GWASCAT_DG	24132900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16007190		★★★★★ ★☆☆☆☆ Found in Text Mining only

TRIM9 (tripartite motif containing 9)