Gene Gene information from NCBI Gene database.
Entrez ID 113878
Gene name Deltex E3 ubiquitin ligase 2
Gene symbol DTX2
Synonyms (NCBI Gene)
RNF58
Chromosome 7
Chromosome location 7q11.23
Summary DTX2 functions as an E3 ubiquitin ligase (Takeyama et al., 2003 [PubMed 12670957]).[supplied by OMIM, Nov 2009]
miRNA miRNA information provided by mirtarbase database.
81
miRTarBase ID miRNA Experiments Reference
MIRT050508 hsa-miR-20a-5p CLASH 23622248
MIRT486947 hsa-miR-6808-5p PAR-CLIP 23592263
MIRT486946 hsa-miR-6893-5p PAR-CLIP 23592263
MIRT486944 hsa-miR-940 PAR-CLIP 23592263
MIRT486945 hsa-miR-4716-3p PAR-CLIP 23592263
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 19549727, 21516116, 24722188, 25416956, 25910212, 31515488, 32296183, 33961781
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IBA
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
613141 15973 ENSG00000091073
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86UW9
Protein name Probable E3 ubiquitin-protein ligase DTX2 (EC 2.3.2.27) (Protein deltex-2) (Deltex2) (hDTX2) (RING finger protein 58) (RING-type E3 ubiquitin transferase DTX2)
Protein function Regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. Probably acts both as a positive and negative regulator of Notch, depending on the developmental
PDB 6IR0 , 6Y22 , 6Y2X , 6Y3J
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02825 WWE 20 97 WWE domain Family
PF02825 WWE 110 174 WWE domain Family
PF00097 zf-C3HC4 412 472 Zinc finger, C3HC4 type (RING finger) Domain
PF18102 DTC 480 614 Deltex C-terminal domain Domain
Sequence
MAMAPSPSLVQVYTSPAAVAVWEWQDGLGTWHPYSATVCSFIEQQFVQQKGQRFGLGSLA
HSIPLGQADPSLAPYIIDLPSWTQFRQDTGTMRAVRR
HLFPQHSAPGRGVVWEWLSDDGS
WTAYEASVCDYLEQQVARGNQLVDLAPLGYNYTVNYTTHTQTNKTSSFCRSVRR
QAGPPY
PVTTIIAPPGHTGVACSCHQCLSGSRTGPVSGRYRHSMTNLPAYPVPQHPPHRTASVFGT
HQAFAPYNKPSLSGARSAPRLNTTNAWGAAPPSLGSQPLYRSSLSHLGPQHLPPGSSTSG
AVSASLPSGPSSSPGSVPATVPMQMPKPSRVQQALAGMTSVLMSAIGLPVCLSRAPQPTS
PPASRLASKSHGSVKRLRKMSVKGATPKPEPEPEQVIKNYTEELKVPPDEDCIICMEKLS
TASGYSDVTDSKAIGSLAVGHLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSC
KTIYGEKT
GTQPQGKMEVLRFQMSLPGHEDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLP
DNAQGRKVLELLKVAWKRRLIFTVGTSSTTGETDTVVWNEIHHKTEMDRNITGHGYPDPN
YLQNVLAELAAQGV
TEDCLEQQ
Sequence length 622
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Notch signaling pathway   Activated NOTCH1 Transmits Signal to the Nucleus
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BRAIN NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Benign neoplasm of brain, unspecified Brain Neoplasms CTD_human_DG 21127729
★☆☆☆☆
Found in Text Mining only
Brain Neoplasms Brain Neoplasms CTD_human_DG 21127729
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Brain Tumor, Primary Brain Neoplasms CTD_human_DG 21127729
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 24023782 Associate
★☆☆☆☆
Found in Text Mining only
leukemia Leukemia BEFREE 22661044
★☆☆☆☆
Found in Text Mining only
Leukemia Leukemia Pubtator 37500075 Inhibit
★☆☆☆☆
Found in Text Mining only
Leukemia, Myelocytic, Acute Leukemia BEFREE 22661044
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of brain Brain Neoplasms CTD_human_DG 21127729
★☆☆☆☆
Found in Text Mining only
Neoplasms, Intracranial Intracranial Neoplasm CTD_human_DG 21127729
★☆☆☆☆
Found in Text Mining only
Primary malignant neoplasm of brain Brain Neoplasms CTD_human_DG 21127729
★☆☆☆☆
Found in Text Mining only