Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1138
Gene name	Cholinergic receptor nicotinic alpha 5 subunit
Gene symbol	CHRNA5
Synonyms (NCBI Gene)	LNCR2
Chromosome	15
Chromosome location	15q25.1
Summary	The protein encoded by this gene is a nicotinic acetylcholine receptor subunit and a member of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. These receptors are thought to be heteropentamers composed of sepa

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs16969968	G>A	Risk-factor, drug-response	Intron variant, missense variant, coding sequence variant

359

Show/Hide all (359)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021766	hsa-miR-132-3p	Microarray	17612493
MIRT047593	hsa-miR-10a-5p	CLASH	23622248
MIRT039616	hsa-miR-615-3p	CLASH	23622248
MIRT891788	hsa-miR-1184	CLIP-seq
MIRT891789	hsa-miR-122	CLIP-seq
MIRT891790	hsa-miR-1224-3p	CLIP-seq
MIRT891791	hsa-miR-125a-3p	CLIP-seq
MIRT891792	hsa-miR-1307	CLIP-seq
MIRT891793	hsa-miR-130a	CLIP-seq
MIRT891794	hsa-miR-130b	CLIP-seq
MIRT891795	hsa-miR-140-3p	CLIP-seq
MIRT891796	hsa-miR-150	CLIP-seq
MIRT891797	hsa-miR-15a	CLIP-seq
MIRT891798	hsa-miR-15b	CLIP-seq
MIRT891799	hsa-miR-16	CLIP-seq
MIRT891800	hsa-miR-1911	CLIP-seq
MIRT891801	hsa-miR-1915	CLIP-seq
MIRT891802	hsa-miR-195	CLIP-seq
MIRT891803	hsa-miR-196a	CLIP-seq
MIRT891804	hsa-miR-196b	CLIP-seq
MIRT891805	hsa-miR-1976	CLIP-seq
MIRT891806	hsa-miR-23a	CLIP-seq
MIRT891807	hsa-miR-23b	CLIP-seq
MIRT891808	hsa-miR-23c	CLIP-seq
MIRT891809	hsa-miR-301a	CLIP-seq
MIRT891810	hsa-miR-301b	CLIP-seq
MIRT891811	hsa-miR-3074-3p	CLIP-seq
MIRT891812	hsa-miR-3135b	CLIP-seq
MIRT891813	hsa-miR-3146	CLIP-seq
MIRT891814	hsa-miR-3148	CLIP-seq
MIRT891815	hsa-miR-3155	CLIP-seq
MIRT891816	hsa-miR-3155b	CLIP-seq
MIRT891817	hsa-miR-3171	CLIP-seq
MIRT891818	hsa-miR-3201	CLIP-seq
MIRT891819	hsa-miR-340	CLIP-seq
MIRT891820	hsa-miR-3620	CLIP-seq
MIRT891821	hsa-miR-3652	CLIP-seq
MIRT891822	hsa-miR-3663-5p	CLIP-seq
MIRT891823	hsa-miR-3666	CLIP-seq
MIRT891824	hsa-miR-3672	CLIP-seq
MIRT891825	hsa-miR-3688-3p	CLIP-seq
MIRT891826	hsa-miR-3691-5p	CLIP-seq
MIRT891827	hsa-miR-3927	CLIP-seq
MIRT891828	hsa-miR-3934	CLIP-seq
MIRT891829	hsa-miR-424	CLIP-seq
MIRT891830	hsa-miR-4270	CLIP-seq
MIRT891831	hsa-miR-4279	CLIP-seq
MIRT891832	hsa-miR-4284	CLIP-seq
MIRT891833	hsa-miR-4295	CLIP-seq
MIRT891834	hsa-miR-4307	CLIP-seq
MIRT891835	hsa-miR-4318	CLIP-seq
MIRT891836	hsa-miR-4418	CLIP-seq
MIRT891837	hsa-miR-4423-5p	CLIP-seq
MIRT891838	hsa-miR-4426	CLIP-seq
MIRT891839	hsa-miR-4430	CLIP-seq
MIRT891840	hsa-miR-4441	CLIP-seq
MIRT891841	hsa-miR-4477b	CLIP-seq
MIRT891842	hsa-miR-4499	CLIP-seq
MIRT891843	hsa-miR-4520a-5p	CLIP-seq
MIRT891844	hsa-miR-4520b-5p	CLIP-seq
MIRT891845	hsa-miR-454	CLIP-seq
MIRT891846	hsa-miR-4638-5p	CLIP-seq
MIRT891847	hsa-miR-4647	CLIP-seq
MIRT891848	hsa-miR-4662b	CLIP-seq
MIRT891849	hsa-miR-4668-3p	CLIP-seq
MIRT891850	hsa-miR-4682	CLIP-seq
MIRT891851	hsa-miR-4693-5p	CLIP-seq
MIRT891852	hsa-miR-4695-3p	CLIP-seq
MIRT891853	hsa-miR-4700-3p	CLIP-seq
MIRT891854	hsa-miR-4722-3p	CLIP-seq
MIRT891855	hsa-miR-4726-3p	CLIP-seq
MIRT891856	hsa-miR-4752	CLIP-seq
MIRT891857	hsa-miR-4772-5p	CLIP-seq
MIRT891858	hsa-miR-4791	CLIP-seq
MIRT891859	hsa-miR-4795-3p	CLIP-seq
MIRT891860	hsa-miR-4797-5p	CLIP-seq
MIRT891861	hsa-miR-484	CLIP-seq
MIRT891862	hsa-miR-497	CLIP-seq
MIRT891863	hsa-miR-498	CLIP-seq
MIRT891864	hsa-miR-509-3-5p	CLIP-seq
MIRT891865	hsa-miR-5095	CLIP-seq
MIRT891866	hsa-miR-509-5p	CLIP-seq
MIRT891867	hsa-miR-548ag	CLIP-seq
MIRT891868	hsa-miR-548ai	CLIP-seq
MIRT891869	hsa-miR-552	CLIP-seq
MIRT891870	hsa-miR-561	CLIP-seq
MIRT891871	hsa-miR-622	CLIP-seq
MIRT891872	hsa-miR-652	CLIP-seq
MIRT891873	hsa-miR-764	CLIP-seq
MIRT891874	hsa-miR-767-5p	CLIP-seq
MIRT891875	hsa-miR-892a	CLIP-seq
MIRT891876	hsa-miR-944	CLIP-seq
MIRT891788	hsa-miR-1184	CLIP-seq
MIRT1964302	hsa-miR-1202	CLIP-seq
MIRT891789	hsa-miR-122	CLIP-seq
MIRT891792	hsa-miR-1307	CLIP-seq
MIRT891793	hsa-miR-130a	CLIP-seq
MIRT891794	hsa-miR-130b	CLIP-seq
MIRT891801	hsa-miR-1915	CLIP-seq
MIRT1964303	hsa-miR-197	CLIP-seq
MIRT891805	hsa-miR-1976	CLIP-seq
MIRT891809	hsa-miR-301a	CLIP-seq
MIRT891810	hsa-miR-301b	CLIP-seq
MIRT891812	hsa-miR-3135b	CLIP-seq
MIRT1964304	hsa-miR-3199	CLIP-seq
MIRT891819	hsa-miR-340	CLIP-seq
MIRT1964305	hsa-miR-3618	CLIP-seq
MIRT891821	hsa-miR-3652	CLIP-seq
MIRT891823	hsa-miR-3666	CLIP-seq
MIRT1964306	hsa-miR-3671	CLIP-seq
MIRT891826	hsa-miR-3691-5p	CLIP-seq
MIRT1964307	hsa-miR-3972	CLIP-seq
MIRT1964308	hsa-miR-411	CLIP-seq
MIRT1964309	hsa-miR-412	CLIP-seq
MIRT891831	hsa-miR-4279	CLIP-seq
MIRT891832	hsa-miR-4284	CLIP-seq
MIRT891833	hsa-miR-4295	CLIP-seq
MIRT891835	hsa-miR-4318	CLIP-seq
MIRT891836	hsa-miR-4418	CLIP-seq
MIRT891837	hsa-miR-4423-5p	CLIP-seq
MIRT891839	hsa-miR-4430	CLIP-seq
MIRT1964310	hsa-miR-4433	CLIP-seq
MIRT1964311	hsa-miR-4438	CLIP-seq
MIRT1964312	hsa-miR-4508	CLIP-seq
MIRT891845	hsa-miR-454	CLIP-seq
MIRT891846	hsa-miR-4638-5p	CLIP-seq
MIRT891851	hsa-miR-4693-5p	CLIP-seq
MIRT891852	hsa-miR-4695-3p	CLIP-seq
MIRT1964313	hsa-miR-4716-5p	CLIP-seq
MIRT891854	hsa-miR-4722-3p	CLIP-seq
MIRT891855	hsa-miR-4726-3p	CLIP-seq
MIRT891856	hsa-miR-4752	CLIP-seq
MIRT1964314	hsa-miR-4755-3p	CLIP-seq
MIRT1964315	hsa-miR-4775	CLIP-seq
MIRT1964316	hsa-miR-4781-3p	CLIP-seq
MIRT1964317	hsa-miR-483-5p	CLIP-seq
MIRT891863	hsa-miR-498	CLIP-seq
MIRT891864	hsa-miR-509-3-5p	CLIP-seq
MIRT891865	hsa-miR-5095	CLIP-seq
MIRT891866	hsa-miR-509-5p	CLIP-seq
MIRT1964318	hsa-miR-515-5p	CLIP-seq
MIRT1964319	hsa-miR-526b	CLIP-seq
MIRT1964320	hsa-miR-590-3p	CLIP-seq
MIRT1964321	hsa-miR-607	CLIP-seq
MIRT891872	hsa-miR-652	CLIP-seq
MIRT891875	hsa-miR-892a	CLIP-seq
MIRT1964322	hsa-miR-934	CLIP-seq
MIRT2200418	hsa-miR-106a	CLIP-seq
MIRT2200419	hsa-miR-106b	CLIP-seq
MIRT891788	hsa-miR-1184	CLIP-seq
MIRT1964302	hsa-miR-1202	CLIP-seq
MIRT891789	hsa-miR-122	CLIP-seq
MIRT891790	hsa-miR-1224-3p	CLIP-seq
MIRT891791	hsa-miR-125a-3p	CLIP-seq
MIRT891792	hsa-miR-1307	CLIP-seq
MIRT891793	hsa-miR-130a	CLIP-seq
MIRT891794	hsa-miR-130b	CLIP-seq
MIRT891796	hsa-miR-150	CLIP-seq
MIRT2200420	hsa-miR-17	CLIP-seq
MIRT2200421	hsa-miR-186	CLIP-seq
MIRT891801	hsa-miR-1915	CLIP-seq
MIRT1964303	hsa-miR-197	CLIP-seq
MIRT891805	hsa-miR-1976	CLIP-seq
MIRT2200422	hsa-miR-20a	CLIP-seq
MIRT2200423	hsa-miR-20b	CLIP-seq
MIRT891809	hsa-miR-301a	CLIP-seq
MIRT891810	hsa-miR-301b	CLIP-seq
MIRT2200424	hsa-miR-302a	CLIP-seq
MIRT2200425	hsa-miR-302b	CLIP-seq
MIRT2200426	hsa-miR-302c	CLIP-seq
MIRT2200427	hsa-miR-302d	CLIP-seq
MIRT2200428	hsa-miR-302e	CLIP-seq
MIRT2200429	hsa-miR-3133	CLIP-seq
MIRT891812	hsa-miR-3135b	CLIP-seq
MIRT891815	hsa-miR-3155	CLIP-seq
MIRT891816	hsa-miR-3155b	CLIP-seq
MIRT1964304	hsa-miR-3199	CLIP-seq
MIRT2200430	hsa-miR-338-3p	CLIP-seq
MIRT891820	hsa-miR-3620	CLIP-seq
MIRT891821	hsa-miR-3652	CLIP-seq
MIRT891822	hsa-miR-3663-5p	CLIP-seq
MIRT891823	hsa-miR-3666	CLIP-seq
MIRT891826	hsa-miR-3691-5p	CLIP-seq
MIRT2200431	hsa-miR-372	CLIP-seq
MIRT2200432	hsa-miR-373	CLIP-seq
MIRT891828	hsa-miR-3934	CLIP-seq
MIRT1964307	hsa-miR-3972	CLIP-seq
MIRT1964308	hsa-miR-411	CLIP-seq
MIRT1964309	hsa-miR-412	CLIP-seq
MIRT891831	hsa-miR-4279	CLIP-seq
MIRT891832	hsa-miR-4284	CLIP-seq
MIRT891833	hsa-miR-4295	CLIP-seq
MIRT891835	hsa-miR-4318	CLIP-seq
MIRT891836	hsa-miR-4418	CLIP-seq
MIRT891837	hsa-miR-4423-5p	CLIP-seq
MIRT891839	hsa-miR-4430	CLIP-seq
MIRT1964311	hsa-miR-4438	CLIP-seq
MIRT2200433	hsa-miR-4474-5p	CLIP-seq
MIRT2200434	hsa-miR-4503	CLIP-seq
MIRT2200435	hsa-miR-4509	CLIP-seq
MIRT2200436	hsa-miR-4530	CLIP-seq
MIRT891845	hsa-miR-454	CLIP-seq
MIRT891846	hsa-miR-4638-5p	CLIP-seq
MIRT891850	hsa-miR-4682	CLIP-seq
MIRT891851	hsa-miR-4693-5p	CLIP-seq
MIRT1964313	hsa-miR-4716-5p	CLIP-seq
MIRT891854	hsa-miR-4722-3p	CLIP-seq
MIRT891855	hsa-miR-4726-3p	CLIP-seq
MIRT2200437	hsa-miR-4731-5p	CLIP-seq
MIRT2200438	hsa-miR-4744	CLIP-seq
MIRT891856	hsa-miR-4752	CLIP-seq
MIRT1964314	hsa-miR-4755-3p	CLIP-seq
MIRT1964316	hsa-miR-4781-3p	CLIP-seq
MIRT1964317	hsa-miR-483-5p	CLIP-seq
MIRT891861	hsa-miR-484	CLIP-seq
MIRT891863	hsa-miR-498	CLIP-seq
MIRT891864	hsa-miR-509-3-5p	CLIP-seq
MIRT891865	hsa-miR-5095	CLIP-seq
MIRT891866	hsa-miR-509-5p	CLIP-seq
MIRT2200439	hsa-miR-512-3p	CLIP-seq
MIRT1964318	hsa-miR-515-5p	CLIP-seq
MIRT2200440	hsa-miR-519d	CLIP-seq
MIRT2200441	hsa-miR-520a-3p	CLIP-seq
MIRT2200442	hsa-miR-520b	CLIP-seq
MIRT2200443	hsa-miR-520c-3p	CLIP-seq
MIRT2200444	hsa-miR-520d-3p	CLIP-seq
MIRT2200445	hsa-miR-520e	CLIP-seq
MIRT2200446	hsa-miR-520g	CLIP-seq
MIRT2200447	hsa-miR-520h	CLIP-seq
MIRT1964319	hsa-miR-526b	CLIP-seq
MIRT2200448	hsa-miR-548v	CLIP-seq
MIRT891869	hsa-miR-552	CLIP-seq
MIRT2200449	hsa-miR-566	CLIP-seq
MIRT891872	hsa-miR-652	CLIP-seq
MIRT891873	hsa-miR-764	CLIP-seq
MIRT891874	hsa-miR-767-5p	CLIP-seq
MIRT891875	hsa-miR-892a	CLIP-seq
MIRT2200450	hsa-miR-93	CLIP-seq
MIRT2200418	hsa-miR-106a	CLIP-seq
MIRT2200419	hsa-miR-106b	CLIP-seq
MIRT891788	hsa-miR-1184	CLIP-seq
MIRT891789	hsa-miR-122	CLIP-seq
MIRT891792	hsa-miR-1307	CLIP-seq
MIRT891793	hsa-miR-130a	CLIP-seq
MIRT891794	hsa-miR-130b	CLIP-seq
MIRT891796	hsa-miR-150	CLIP-seq
MIRT2200420	hsa-miR-17	CLIP-seq
MIRT891801	hsa-miR-1915	CLIP-seq
MIRT2200422	hsa-miR-20a	CLIP-seq
MIRT2200423	hsa-miR-20b	CLIP-seq
MIRT891809	hsa-miR-301a	CLIP-seq
MIRT891810	hsa-miR-301b	CLIP-seq
MIRT2200424	hsa-miR-302a	CLIP-seq
MIRT2200425	hsa-miR-302b	CLIP-seq
MIRT2200426	hsa-miR-302c	CLIP-seq
MIRT2200427	hsa-miR-302d	CLIP-seq
MIRT2200428	hsa-miR-302e	CLIP-seq
MIRT891812	hsa-miR-3135b	CLIP-seq
MIRT891821	hsa-miR-3652	CLIP-seq
MIRT891823	hsa-miR-3666	CLIP-seq
MIRT2200431	hsa-miR-372	CLIP-seq
MIRT2200432	hsa-miR-373	CLIP-seq
MIRT891832	hsa-miR-4284	CLIP-seq
MIRT891833	hsa-miR-4295	CLIP-seq
MIRT891836	hsa-miR-4418	CLIP-seq
MIRT891837	hsa-miR-4423-5p	CLIP-seq
MIRT891839	hsa-miR-4430	CLIP-seq
MIRT891845	hsa-miR-454	CLIP-seq
MIRT891846	hsa-miR-4638-5p	CLIP-seq
MIRT891852	hsa-miR-4695-3p	CLIP-seq
MIRT891855	hsa-miR-4726-3p	CLIP-seq
MIRT891864	hsa-miR-509-3-5p	CLIP-seq
MIRT891866	hsa-miR-509-5p	CLIP-seq
MIRT2200440	hsa-miR-519d	CLIP-seq
MIRT2200441	hsa-miR-520a-3p	CLIP-seq
MIRT2200442	hsa-miR-520b	CLIP-seq
MIRT2200443	hsa-miR-520c-3p	CLIP-seq
MIRT2200444	hsa-miR-520d-3p	CLIP-seq
MIRT2200445	hsa-miR-520e	CLIP-seq
MIRT2200446	hsa-miR-520g	CLIP-seq
MIRT2200447	hsa-miR-520h	CLIP-seq
MIRT2386066	hsa-miR-576-3p	CLIP-seq
MIRT891872	hsa-miR-652	CLIP-seq
MIRT2200450	hsa-miR-93	CLIP-seq
MIRT891788	hsa-miR-1184	CLIP-seq
MIRT891792	hsa-miR-1307	CLIP-seq
MIRT2447011	hsa-miR-1910	CLIP-seq
MIRT891801	hsa-miR-1915	CLIP-seq
MIRT891805	hsa-miR-1976	CLIP-seq
MIRT2447012	hsa-miR-2114	CLIP-seq
MIRT2447013	hsa-miR-3129-3p	CLIP-seq
MIRT891821	hsa-miR-3652	CLIP-seq
MIRT891831	hsa-miR-4279	CLIP-seq
MIRT891832	hsa-miR-4284	CLIP-seq
MIRT891836	hsa-miR-4418	CLIP-seq
MIRT891837	hsa-miR-4423-5p	CLIP-seq
MIRT891839	hsa-miR-4430	CLIP-seq
MIRT2447014	hsa-miR-455-3p	CLIP-seq
MIRT891846	hsa-miR-4638-5p	CLIP-seq
MIRT891854	hsa-miR-4722-3p	CLIP-seq
MIRT891855	hsa-miR-4726-3p	CLIP-seq
MIRT2447015	hsa-miR-4780	CLIP-seq
MIRT891863	hsa-miR-498	CLIP-seq
MIRT891864	hsa-miR-509-3-5p	CLIP-seq
MIRT891866	hsa-miR-509-5p	CLIP-seq
MIRT2447016	hsa-miR-623	CLIP-seq
MIRT891789	hsa-miR-122	CLIP-seq
MIRT891793	hsa-miR-130a	CLIP-seq
MIRT891794	hsa-miR-130b	CLIP-seq
MIRT891801	hsa-miR-1915	CLIP-seq
MIRT891805	hsa-miR-1976	CLIP-seq
MIRT891809	hsa-miR-301a	CLIP-seq
MIRT891810	hsa-miR-301b	CLIP-seq
MIRT891812	hsa-miR-3135b	CLIP-seq
MIRT891821	hsa-miR-3652	CLIP-seq
MIRT891823	hsa-miR-3666	CLIP-seq
MIRT891824	hsa-miR-3672	CLIP-seq
MIRT891831	hsa-miR-4279	CLIP-seq
MIRT891833	hsa-miR-4295	CLIP-seq
MIRT891837	hsa-miR-4423-5p	CLIP-seq
MIRT891839	hsa-miR-4430	CLIP-seq
MIRT891842	hsa-miR-4499	CLIP-seq
MIRT891845	hsa-miR-454	CLIP-seq
MIRT891850	hsa-miR-4682	CLIP-seq
MIRT891852	hsa-miR-4695-3p	CLIP-seq
MIRT891854	hsa-miR-4722-3p	CLIP-seq
MIRT891855	hsa-miR-4726-3p	CLIP-seq
MIRT891863	hsa-miR-498	CLIP-seq
MIRT1964319	hsa-miR-526b	CLIP-seq
MIRT891788	hsa-miR-1184	CLIP-seq
MIRT891789	hsa-miR-122	CLIP-seq
MIRT891792	hsa-miR-1307	CLIP-seq
MIRT891793	hsa-miR-130a	CLIP-seq
MIRT891794	hsa-miR-130b	CLIP-seq
MIRT891801	hsa-miR-1915	CLIP-seq
MIRT891805	hsa-miR-1976	CLIP-seq
MIRT891809	hsa-miR-301a	CLIP-seq
MIRT891810	hsa-miR-301b	CLIP-seq
MIRT891812	hsa-miR-3135b	CLIP-seq
MIRT891821	hsa-miR-3652	CLIP-seq
MIRT891823	hsa-miR-3666	CLIP-seq
MIRT891824	hsa-miR-3672	CLIP-seq
MIRT891831	hsa-miR-4279	CLIP-seq
MIRT891832	hsa-miR-4284	CLIP-seq
MIRT891833	hsa-miR-4295	CLIP-seq
MIRT891836	hsa-miR-4418	CLIP-seq
MIRT891837	hsa-miR-4423-5p	CLIP-seq
MIRT891839	hsa-miR-4430	CLIP-seq
MIRT891842	hsa-miR-4499	CLIP-seq
MIRT891845	hsa-miR-454	CLIP-seq
MIRT891846	hsa-miR-4638-5p	CLIP-seq
MIRT891850	hsa-miR-4682	CLIP-seq
MIRT891852	hsa-miR-4695-3p	CLIP-seq
MIRT891854	hsa-miR-4722-3p	CLIP-seq
MIRT891855	hsa-miR-4726-3p	CLIP-seq
MIRT891863	hsa-miR-498	CLIP-seq
MIRT891864	hsa-miR-509-3-5p	CLIP-seq
MIRT891866	hsa-miR-509-5p	CLIP-seq
MIRT1964319	hsa-miR-526b	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
ASCL1	Unknown	20124469

Show/Hide all (45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005230	Function	Extracellular ligand-gated monoatomic ion channel activity	IEA
GO:0005515	Function	Protein binding	IPI	8663494, 27344019, 33961781
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005892	Component	Acetylcholine-gated channel complex	IBA
GO:0005892	Component	Acetylcholine-gated channel complex	IC	1542648
GO:0005892	Component	Acetylcholine-gated channel complex	IDA	20881005
GO:0005892	Component	Acetylcholine-gated channel complex	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0007165	Process	Signal transduction	NAS	9009220
GO:0007268	Process	Chemical synaptic transmission	TAS	9009220
GO:0007271	Process	Synaptic transmission, cholinergic	IBA
GO:0007274	Process	Neuromuscular synaptic transmission	IBA
GO:0015276	Function	Ligand-gated monoatomic ion channel activity	TAS	20438829
GO:0015464	Function	Acetylcholine receptor activity	IDA	1542648
GO:0016020	Component	Membrane	IEA
GO:0022848	Function	Acetylcholine-gated monoatomic cation-selective channel activity	IBA
GO:0022848	Function	Acetylcholine-gated monoatomic cation-selective channel activity	IEA
GO:0022848	Function	Acetylcholine-gated monoatomic cation-selective channel activity	NAS	1542648
GO:0022848	Function	Acetylcholine-gated monoatomic cation-selective channel activity	TAS	20438829
GO:0034220	Process	Monoatomic ion transmembrane transport	IBA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034703	Component	Cation channel complex	IDA	20881005
GO:0035094	Process	Response to nicotine	IBA
GO:0035094	Process	Response to nicotine	IEA
GO:0035094	Process	Response to nicotine	IEA
GO:0035095	Process	Behavioral response to nicotine	IMP	18227835
GO:0043005	Component	Neuron projection	IBA
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0051899	Process	Membrane depolarization	IBA
GO:0060078	Process	Regulation of postsynaptic membrane potential	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0095500	Process	Acetylcholine receptor signaling pathway	IBA
GO:0097060	Component	Synaptic membrane	IEA
GO:0098691	Component	Dopaminergic synapse	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098878	Component	Neurotransmitter receptor complex	IDA	20881005
GO:0098981	Component	Cholinergic synapse	IEA
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IBA
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IEA

MIM	HGNC	e!Ensembl
118505	1959	ENSG00000169684

P30532

Protein name

Neuronal acetylcholine receptor subunit alpha-5

Protein function

Component of neuronal acetylcholine receptors (nAChRs) that function as pentameric, ligand-gated cation channels with high calcium permeability among other activities. nAChRs are excitatory neurotrasnmitter receptors formed by a collection of nA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02931	Neur_chan_LBD	47 → 250	Neurotransmitter-gated ion-channel ligand binding domain	Family
PF02932	Neur_chan_memb	257 → 381	Neurotransmitter-gated ion-channel transmembrane region	Family
PF02932	Neur_chan_memb	368 → 447	Neurotransmitter-gated ion-channel transmembrane region	Family

Sequence

MAARGSGPRALRLLLLVQLVAGRCGLAGAAGGAQRGLSEPSSIAKHEDSLLKDLFQDYER
WVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKV
IRVPSDSVWTPDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFD
LQNCSMKFGSWTYDGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYV
TYSFVIKRLPLFYTLFLIIPCIGLSFLTVLVFYLPSNEGEKICLCTSVLVSLTVFLLVIE
EIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAPLVRKIFLHTL
PKLLCMRSHVDRYFTQKEETESGSGPKSSRNTLEAALDSIRYITRHIMKENDVREVVEDW
KFIAQVLDRMFLWTFLFVSIVGSLGLFVPVIYKWANILIPVHIGNANK

Sequence length

468

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction		Highly calcium permeable postsynaptic nicotinic acetylcholine receptors Highly calcium permeable nicotinic acetylcholine receptors

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (35)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANXIETY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHUS CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC BRONCHITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LUNG DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EMPHYSEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung adenocarcinoma	Uncertain significance	ClinVar GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer susceptibility 2	drug response	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
nicotine response - Toxicity	drug response	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL VASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMOKING AS A QUANTITATIVE TRAIT LOCUS 3	Likely benign; drug response	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Uncertain significance	ClinVar GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Susceptibility to severe coronavirus disease (COVID-19) due to high levels of fibrinogen and C-reactive protein	drug response	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (97)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	19223495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	19223495, 19577767, 23430818, 25233467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	GWASDB_DG	19836008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	GWASCAT_DG	28604730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	23689675	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	CTD_human_DG	19220484, 29944862		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety States, Neurotic	Anxiety Disorder	CTD_human_DG	19220484, 29944862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	27187070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	27187070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30097758		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention Deficit and Disruptive Behavior Disorders	Attention deficit hyperactivity disorder	Pubtator	26228411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	27302872, 30311670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal Dominant Nocturnal Frontal Lobe Epilepsy	Nocturnal Epilepsy	BEFREE	10771020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	23196875	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Diseases	Brain disease	Pubtator	34206324	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30543688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30543688	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18957677, 19010884, 19223495, 19247474, 19443489, 19465454, 19577767, 19641473, 19733931, 19955392, 20124469, 20554942, 20564069, 20581870, 20587604 View all (44 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	GWASCAT_DG	27393504, 28604730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21586512, 29486777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	21646606, 30097758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	26689306, 30882151	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Child Development Disorders, Pervasive	Development Disorder	GWASCAT_DG	28540026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	20564069, 20584212, 21685187, 21949713, 21955800, 23061658, 23077662, 25072098, 25565795, 25891420, 26689306, 26771213, 27462996, 27835950, 28474623, 28724417, 29993116 View all (2 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	25101718, 26634245, 28166215, 29767774		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronobiology Disorders	Chronobiology disorder	Pubtator	36230899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	CTD_human_DG	14996991, 9495872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	25384568, 30366711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	29688464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	CTD_human_DG	14996991, 9495872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cor pulmonale	Cor pulmonale	BEFREE	26689306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	21335511	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	28921935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	27322064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Early onset schizophrenia	Schizophrenia	BEFREE	30366711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	20656943, 21232152, 27669027	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy Rolandic	Rolandic epilepsy	Pubtator	32580138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	14996991, 9495872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	19776245, 21335511	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	23844051	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27610024	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	14996991, 9495872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	24588897	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	31599127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	39832463	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	27187070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	25384568, 30366711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	26771213, 29688464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29688464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	31362771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	29688464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	14996991, 9495872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	25072098, 33752734, 34206324	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	18385676, 18957677, 19010884		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	18385676, 18780872, 18957677, 18978134, 19010884, 19247474, 19300482, 19443489, 19641473, 19706762, 19776245, 20056643, 20124469, 20395203, 20548021 View all (44 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	18385738		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	31599127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30543688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	18385738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18957677, 19010884, 19223495, 19247474, 19443489, 19465454, 19577767, 19641473, 19733931, 19955392, 20124469, 20554942, 20564069, 20581870, 20587604 View all (44 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	GWASDB_DG	22899653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23576140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19465454, 21646606, 23844051, 25329654, 26689306, 28045487, 28878681, 30543688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	27344179	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28921935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	22336398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	24505444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	24727484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	24727484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	25329654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	25329654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30543688		★★★★★ ★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	16314871, 24588897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27050379, 29416783		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	GWASCAT_DG	31326317		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	23692359, 23729684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26771213	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paranoia	Paranoia	BEFREE	23308091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paranoid Disorders	Paranoia	Pubtator	23308091	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	21228559, 22884254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	26689306, 26952864	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	26184988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	25297392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	18978134, 19300482, 20584212, 20656943, 21232152, 21949713, 22438921, 22438940, 22461431, 23443019, 25072098, 26689306, 26751916, 26771213, 26917578 View all (11 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	21418140, 23196875, 28112735, 28921935, 30142156, 30202994, 30366711, 31342675		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	21418140, 23196875		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	23196875, 29228394, 30142156, 31342675, 40082977	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	28540026		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Single Seizure	Seizure	CTD_human_DG	14996991, 9495872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	GWASCAT_DG	28604730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	29486777	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spinocerebellar Ataxia Autosomal Recessive 2	Spinocerebellar ataxia	Pubtator	19247474	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23844051, 27610024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	30829278	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23576140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	CTD_human_DG	14996991, 9495872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Visual seizure	Seizure	CTD_human_DG	14996991, 9495872		★★★★★ ★☆☆☆☆ Found in Text Mining only

CHRNA5 (cholinergic receptor nicotinic alpha 5 subunit)