CIMAP1A (ciliary microtubule associated protein 1A)

Gene

• Entrez ID: 113746
• Gene name: Ciliary microtubule associated protein 1A
• Gene symbol: CIMAP1A
• Synonyms (NCBI Gene): CT135, ODF3, SHIPPO1, TISP50
• Chromosome: 11
• Chromosome location: 11p15.5

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2455598	hsa-miR-1205	CLIP-seq
MIRT2455599	hsa-miR-146b-3p	CLIP-seq
MIRT2455600	hsa-miR-1909	CLIP-seq
MIRT2455601	hsa-miR-1913	CLIP-seq
MIRT2455602	hsa-miR-3173-5p	CLIP-seq
MIRT2455603	hsa-miR-3194-3p	CLIP-seq
MIRT2455604	hsa-miR-324-3p	CLIP-seq
MIRT2455605	hsa-miR-3918	CLIP-seq
MIRT2455606	hsa-miR-4640-5p	CLIP-seq
MIRT2455607	hsa-miR-4726-5p	CLIP-seq
MIRT2455608	hsa-miR-4755-3p	CLIP-seq
MIRT2455609	hsa-miR-874	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001520	Component	Outer dense fiber	IBA
GO:0001520	Component	Outer dense fiber	IEA
GO:0005515	Function	Protein binding	IPI	23355646, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IBA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005929	Component	Cilium	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030317	Process	Flagellated sperm motility	IEA
GO:0031514	Component	Motile cilium	IEA
GO:0036126	Component	Sperm flagellum	IEA
GO:0042995	Component	Cell projection	IEA

Other IDs

• MIM: 608356
• HGNC: 19905
• e!Ensembl: ENSG00000177947

Protein

• UniProt ID: Q96PU9
• Protein name: Ciliary microtubule associated protein 1A (Outer dense fiber of sperm tails protein 3) (Outer dense fiber protein 3) (Sperm tail protein SHIPPO 1) (Transcript induced in spermiogenesis protein 50)
• Protein function: Outer dense fibers are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail. May help to maintain the passive elastic structures and elastic recoil of the sperm tail. {ECO:0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07004	SHIPPO-rpt	25 → 60	Sperm-tail PG-rich repeat	Repeat
  PF07004	SHIPPO-rpt	100 → 131	Sperm-tail PG-rich repeat	Repeat
  PF07004	SHIPPO-rpt	136 → 170	Sperm-tail PG-rich repeat	Repeat
  PF07004	SHIPPO-rpt	215 → 245	Sperm-tail PG-rich repeat	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Testis-specific. {ECO:0000269|PubMed:11870087, ECO:0000269|Ref.2}.
• Sequence:

  MTEEVWMGTWRPHRPRGPIMALYSSPGPKYLIPPTTGFMKHTPTKLRAPAYSFRGAPMLL
  AENCSPGPRYNVNPKILRTGKDLGPAYSILGRYQTKTMLTPGPGDYFPEKSTKYVFDSAP
  SHSISARTKAFRVDSTPGPAAYMLPMVMGPNTVGKASQPSFSIKGRSKLGGFSDDLHKTP
  GPAAYRQTDVRVTKFKAPQYTMAARVEPPGDKTLKPGPGAHSPEKVTLTKPCAPVVTFGI
  KHSDYMTPLLVDVE

• Sequence length: 254

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BENIGN PROSTATIC HYPERPLASIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	23096689		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	GWASCAT_DG	30410027		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma, Basal Cell	Carcinoma	BEFREE	19886887		★☆☆☆☆ Found in Text Mining only