Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	113622
Gene name	ADP-ribosylhydrolase like 1
Gene symbol	ADPRHL1
Synonyms (NCBI Gene)	ARH2
Chromosome	13
Chromosome location	13q34
Summary	ADP-ribosylation is a reversible posttranslational modification used to regulate protein function. ADP-ribosyltransferases (see ART1; MIM 601625) transfer ADP-ribose from NAD+ to the target protein, and ADP-ribosylhydrolases, such as ADPRHL1, reverse the

Show/Hide all (61)

miRTarBase ID	miRNA	Experiments	Reference
MIRT488731	hsa-miR-3174	PAR-CLIP	23592263
MIRT488730	hsa-miR-4255	PAR-CLIP	23592263
MIRT488729	hsa-miR-4795-5p	PAR-CLIP	23592263
MIRT488728	hsa-miR-1236-5p	PAR-CLIP	23592263
MIRT488727	hsa-miR-4765	PAR-CLIP	23592263
MIRT488726	hsa-miR-30a-5p	PAR-CLIP	23592263
MIRT488725	hsa-miR-30b-5p	PAR-CLIP	23592263
MIRT488724	hsa-miR-30c-5p	PAR-CLIP	23592263
MIRT488723	hsa-miR-30d-5p	PAR-CLIP	23592263
MIRT488722	hsa-miR-30e-5p	PAR-CLIP	23592263
MIRT488721	hsa-miR-142-3p	PAR-CLIP	23592263
MIRT488720	hsa-miR-3616-5p	PAR-CLIP	23592263
MIRT488719	hsa-miR-573	PAR-CLIP	23592263
MIRT488718	hsa-miR-653-5p	PAR-CLIP	23592263
MIRT488717	hsa-miR-3591-5p	PAR-CLIP	23592263
MIRT488731	hsa-miR-3174	PAR-CLIP	23592263
MIRT488730	hsa-miR-4255	PAR-CLIP	23592263
MIRT488729	hsa-miR-4795-5p	PAR-CLIP	23592263
MIRT488728	hsa-miR-1236-5p	PAR-CLIP	23592263
MIRT488727	hsa-miR-4765	PAR-CLIP	23592263
MIRT488726	hsa-miR-30a-5p	PAR-CLIP	23592263
MIRT488725	hsa-miR-30b-5p	PAR-CLIP	23592263
MIRT488724	hsa-miR-30c-5p	PAR-CLIP	23592263
MIRT488723	hsa-miR-30d-5p	PAR-CLIP	23592263
MIRT488722	hsa-miR-30e-5p	PAR-CLIP	23592263
MIRT488721	hsa-miR-142-3p	PAR-CLIP	23592263
MIRT488720	hsa-miR-3616-5p	PAR-CLIP	23592263
MIRT488719	hsa-miR-573	PAR-CLIP	23592263
MIRT488718	hsa-miR-653-5p	PAR-CLIP	23592263
MIRT488717	hsa-miR-3591-5p	PAR-CLIP	23592263
MIRT769759	hsa-miR-3689a-3p	CLIP-seq
MIRT769760	hsa-miR-3689c	CLIP-seq
MIRT769761	hsa-miR-4318	CLIP-seq
MIRT769762	hsa-miR-4447	CLIP-seq
MIRT769763	hsa-miR-4472	CLIP-seq
MIRT769764	hsa-miR-4651	CLIP-seq
MIRT769765	hsa-miR-4728-5p	CLIP-seq
MIRT769766	hsa-miR-551a	CLIP-seq
MIRT769767	hsa-miR-551b	CLIP-seq
MIRT769768	hsa-miR-608	CLIP-seq
MIRT769769	hsa-miR-665	CLIP-seq
MIRT769770	hsa-miR-873	CLIP-seq
MIRT769771	hsa-miR-219-1-3p	CLIP-seq
MIRT769772	hsa-miR-3613-3p	CLIP-seq
MIRT739385	hsa-miR-4704-3p	CLIP-seq
MIRT769773	hsa-miR-571	CLIP-seq
MIRT769774	hsa-miR-607	CLIP-seq
MIRT769762	hsa-miR-4447	CLIP-seq
MIRT769763	hsa-miR-4472	CLIP-seq
MIRT769764	hsa-miR-4651	CLIP-seq
MIRT1545168	hsa-miR-4723-5p	CLIP-seq
MIRT769768	hsa-miR-608	CLIP-seq
MIRT1927060	hsa-miR-1203	CLIP-seq
MIRT1927061	hsa-miR-1207-5p	CLIP-seq
MIRT1927062	hsa-miR-139-3p	CLIP-seq
MIRT1927063	hsa-miR-4459	CLIP-seq
MIRT1927064	hsa-miR-4487	CLIP-seq
MIRT1927065	hsa-miR-4695-5p	CLIP-seq
MIRT1927066	hsa-miR-4722-5p	CLIP-seq
MIRT1927067	hsa-miR-4736	CLIP-seq
MIRT1927068	hsa-miR-4763-3p	CLIP-seq

Show/Hide all (8)

GO ID	Ontology	Definition	Evidence
GO:0000287	Function	Magnesium ion binding	IEA
GO:0003242	Process	Cardiac chamber ballooning	ISS
GO:0003875	Function	ADP-ribosylarginine hydrolase activity	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0030017	Component	Sarcomere	IEA
GO:0030017	Component	Sarcomere	ISS
GO:0051725	Process	Protein de-ADP-ribosylation	IEA
GO:0055003	Process	Cardiac myofibril assembly	ISS

MIM	HGNC	e!Ensembl
610620	21303	ENSG00000153531

Q8NDY3

Protein name

Inactive ADP-ribosyltransferase ARH2 (ADP-ribosylhydrolase-like protein 1) ([Protein ADP-ribosylarginine] hydrolase-like protein 1)

Protein function

Required for myofibril assembly and outgrowth of the cardiac chambers in the developing heart (By similarity). Appears to be catalytically inactive, showing no activity against O-acetyl-ADP-ribose (By similarity). {ECO:0000250|UniProtKB:Q6AZR2,

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03747	ADP_ribosyl_GH	6 → 328	ADP-ribosylglycohydrolase	Family

Sequence

MEKFKAAMLLGSVGDALGYRNVCKENSTVGMKIQEELQRSGGLDHLVLSPGEWPVSDNTI
MHIATAEALTTDYWCLDDLYREMVRCYVEIVEKLPERRPDPATIEGCAQLKPNNYLLAWH
TPFNEKGSGFGAATKAMCIGLRYWKPERLETLIEVSVECGRMTHNHPTGFLGSLCTALFV
SFAAQGKPLVQWGRDMLRAVPLAEEYCRKTIRHTAEYQEHWFYFEAKWQFYLEERKISKD
SENKAIFPDNYDAEEREKTYRKWSSEGRGGRRGHDAPMIAYDALLAAGNSWTELCHRAMF
HGGESAATGTIAGCLFGLLYGLDLVPKGLYQDLEDKEKLEDLGAALYRLSTEEK

Sequence length

354

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinogenesis	Carcinogenesis	Pubtator	35816343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	38302034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	35216615	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35816343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	29031853		★★★★★ ★☆☆☆☆ Found in Text Mining only

ADPRHL1 (ADP-ribosylhydrolase like 1)