Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	11346
Gene name	Synaptopodin
Gene symbol	SYNPO
Synonyms (NCBI Gene)	SYNPO1
Chromosome	5
Chromosome location	5q33.1
Summary	Synaptopodin is an actin-associated protein that may play a role in actin-based cell shape and motility. The name synaptopodin derives from the protein`s associations with postsynaptic densities and dendritic spines and with renal podocytes (Mundel et al.

183

Show/Hide all (183)

miRTarBase ID	miRNA	Experiments	Reference
MIRT686735	hsa-miR-4311	HITS-CLIP	23313552
MIRT608417	hsa-miR-6867-5p	HITS-CLIP	23313552
MIRT608416	hsa-miR-6818-5p	HITS-CLIP	23313552
MIRT608415	hsa-miR-574-5p	HITS-CLIP	23313552
MIRT608417	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT608416	hsa-miR-6818-5p	HITS-CLIP	24906430
MIRT608415	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT608417	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT608416	hsa-miR-6818-5p	HITS-CLIP	24906430
MIRT608415	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT608417	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT608416	hsa-miR-6818-5p	HITS-CLIP	24906430
MIRT608415	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT530550	hsa-miR-6835-3p	PAR-CLIP	22012620
MIRT530549	hsa-miR-10a-5p	PAR-CLIP	22012620
MIRT530548	hsa-miR-10b-5p	PAR-CLIP	22012620
MIRT530547	hsa-miR-6871-3p	PAR-CLIP	22012620
MIRT530546	hsa-miR-330-3p	PAR-CLIP	22012620
MIRT530545	hsa-miR-3620-3p	PAR-CLIP	22012620
MIRT530544	hsa-miR-339-5p	PAR-CLIP	22012620
MIRT530543	hsa-miR-6748-3p	PAR-CLIP	22012620
MIRT530542	hsa-miR-130b-5p	PAR-CLIP	22012620
MIRT530541	hsa-miR-4433a-5p	PAR-CLIP	22012620
MIRT530540	hsa-miR-1298-5p	PAR-CLIP	22012620
MIRT530539	hsa-miR-4433b-5p	PAR-CLIP	22012620
MIRT686735	hsa-miR-4311	PAR-CLIP	27292025
MIRT575652	hsa-miR-574-5p	PAR-CLIP	27292025
MIRT575653	hsa-miR-6818-5p	PAR-CLIP	27292025
MIRT575654	hsa-miR-6867-5p	PAR-CLIP	27292025
MIRT686735	hsa-miR-4311	HITS-CLIP	27418678
MIRT686735	hsa-miR-4311	HITS-CLIP	27418678
MIRT575652	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT575652	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT575652	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT575652	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT575652	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT575652	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT575653	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT575653	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT575653	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT575653	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT575653	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT575653	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT575654	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT575654	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT575654	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT575654	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT575654	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT575654	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT686735	hsa-miR-4311	HITS-CLIP	23313552
MIRT575654	hsa-miR-6867-5p	HITS-CLIP	23313552
MIRT575653	hsa-miR-6818-5p	HITS-CLIP	23313552
MIRT575652	hsa-miR-574-5p	HITS-CLIP	23313552
MIRT530550	hsa-miR-6835-3p	PAR-CLIP	22012620
MIRT530549	hsa-miR-10a-5p	PAR-CLIP	22012620
MIRT530548	hsa-miR-10b-5p	PAR-CLIP	22012620
MIRT530547	hsa-miR-6871-3p	PAR-CLIP	22012620
MIRT530546	hsa-miR-330-3p	PAR-CLIP	22012620
MIRT530545	hsa-miR-3620-3p	PAR-CLIP	22012620
MIRT530544	hsa-miR-339-5p	PAR-CLIP	22012620
MIRT530543	hsa-miR-6748-3p	PAR-CLIP	22012620
MIRT530542	hsa-miR-130b-5p	PAR-CLIP	22012620
MIRT530541	hsa-miR-4433a-5p	PAR-CLIP	22012620
MIRT530540	hsa-miR-1298-5p	PAR-CLIP	22012620
MIRT530539	hsa-miR-4433b-5p	PAR-CLIP	22012620
MIRT1406610	hsa-miR-338-3p	CLIP-seq
MIRT1406611	hsa-miR-4530	CLIP-seq
MIRT1406612	hsa-miR-1231	CLIP-seq
MIRT1406613	hsa-miR-15a	CLIP-seq
MIRT1406614	hsa-miR-15b	CLIP-seq
MIRT1406615	hsa-miR-16	CLIP-seq
MIRT1406616	hsa-miR-195	CLIP-seq
MIRT1406617	hsa-miR-214	CLIP-seq
MIRT1406618	hsa-miR-3117-5p	CLIP-seq
MIRT1406619	hsa-miR-3148	CLIP-seq
MIRT1406620	hsa-miR-3154	CLIP-seq
MIRT1406621	hsa-miR-3179	CLIP-seq
MIRT1406622	hsa-miR-3185	CLIP-seq
MIRT1406623	hsa-miR-3192	CLIP-seq
MIRT1406624	hsa-miR-3202	CLIP-seq
MIRT1406625	hsa-miR-3616-3p	CLIP-seq
MIRT1406626	hsa-miR-3619-5p	CLIP-seq
MIRT1406627	hsa-miR-3660	CLIP-seq
MIRT1406628	hsa-miR-3688-3p	CLIP-seq
MIRT1406629	hsa-miR-424	CLIP-seq
MIRT1406630	hsa-miR-4314	CLIP-seq
MIRT1406631	hsa-miR-4461	CLIP-seq
MIRT1406632	hsa-miR-4475	CLIP-seq
MIRT1406633	hsa-miR-4526	CLIP-seq
MIRT1406611	hsa-miR-4530	CLIP-seq
MIRT1406634	hsa-miR-4640-5p	CLIP-seq
MIRT1406635	hsa-miR-4646-5p	CLIP-seq
MIRT1406636	hsa-miR-4688	CLIP-seq
MIRT1406637	hsa-miR-4721	CLIP-seq
MIRT1406638	hsa-miR-4726-5p	CLIP-seq
MIRT1406639	hsa-miR-4729	CLIP-seq
MIRT1406640	hsa-miR-4747-5p	CLIP-seq
MIRT1406641	hsa-miR-497	CLIP-seq
MIRT1406642	hsa-miR-558	CLIP-seq
MIRT1406643	hsa-miR-570	CLIP-seq
MIRT1406644	hsa-miR-711	CLIP-seq
MIRT1406645	hsa-miR-761	CLIP-seq
MIRT1557164	hsa-miR-4722-3p	CLIP-seq
MIRT1920943	hsa-miR-3127-5p	CLIP-seq
MIRT1920944	hsa-miR-3162-3p	CLIP-seq
MIRT1920945	hsa-miR-324-5p	CLIP-seq
MIRT1920946	hsa-miR-3605-5p	CLIP-seq
MIRT1920947	hsa-miR-3918	CLIP-seq
MIRT1920948	hsa-miR-4446-3p	CLIP-seq
MIRT1920949	hsa-miR-4711-5p	CLIP-seq
MIRT1920950	hsa-miR-4719	CLIP-seq
MIRT1920951	hsa-miR-4749-3p	CLIP-seq
MIRT1920952	hsa-miR-4753-5p	CLIP-seq
MIRT1920943	hsa-miR-3127-5p	CLIP-seq
MIRT1920944	hsa-miR-3162-3p	CLIP-seq
MIRT1920945	hsa-miR-324-5p	CLIP-seq
MIRT1920946	hsa-miR-3605-5p	CLIP-seq
MIRT1920947	hsa-miR-3918	CLIP-seq
MIRT1920948	hsa-miR-4446-3p	CLIP-seq
MIRT1920949	hsa-miR-4711-5p	CLIP-seq
MIRT1920950	hsa-miR-4719	CLIP-seq
MIRT1920951	hsa-miR-4749-3p	CLIP-seq
MIRT1920952	hsa-miR-4753-5p	CLIP-seq
MIRT1920943	hsa-miR-3127-5p	CLIP-seq
MIRT1920944	hsa-miR-3162-3p	CLIP-seq
MIRT1920945	hsa-miR-324-5p	CLIP-seq
MIRT1920946	hsa-miR-3605-5p	CLIP-seq
MIRT1920947	hsa-miR-3918	CLIP-seq
MIRT1920948	hsa-miR-4446-3p	CLIP-seq
MIRT1920949	hsa-miR-4711-5p	CLIP-seq
MIRT1920950	hsa-miR-4719	CLIP-seq
MIRT1920951	hsa-miR-4749-3p	CLIP-seq
MIRT1920952	hsa-miR-4753-5p	CLIP-seq
MIRT2121950	hsa-miR-1197	CLIP-seq
MIRT2121951	hsa-miR-1286	CLIP-seq
MIRT2121952	hsa-miR-1827	CLIP-seq
MIRT1406618	hsa-miR-3117-5p	CLIP-seq
MIRT2121953	hsa-miR-3144-5p	CLIP-seq
MIRT1406620	hsa-miR-3154	CLIP-seq
MIRT1406621	hsa-miR-3179	CLIP-seq
MIRT1406622	hsa-miR-3185	CLIP-seq
MIRT2121954	hsa-miR-374a	CLIP-seq
MIRT2121955	hsa-miR-374b	CLIP-seq
MIRT2121956	hsa-miR-4436a	CLIP-seq
MIRT2121957	hsa-miR-940	CLIP-seq
MIRT1406613	hsa-miR-15a	CLIP-seq
MIRT1406614	hsa-miR-15b	CLIP-seq
MIRT1406615	hsa-miR-16	CLIP-seq
MIRT1406616	hsa-miR-195	CLIP-seq
MIRT1406617	hsa-miR-214	CLIP-seq
MIRT2343855	hsa-miR-27a	CLIP-seq
MIRT2343856	hsa-miR-27b	CLIP-seq
MIRT2343857	hsa-miR-3136-3p	CLIP-seq
MIRT2343858	hsa-miR-3612	CLIP-seq
MIRT1406626	hsa-miR-3619-5p	CLIP-seq
MIRT2343859	hsa-miR-412	CLIP-seq
MIRT1406629	hsa-miR-424	CLIP-seq
MIRT2343860	hsa-miR-4722-5p	CLIP-seq
MIRT1406640	hsa-miR-4747-5p	CLIP-seq
MIRT1406641	hsa-miR-497	CLIP-seq
MIRT2343861	hsa-miR-513a-5p	CLIP-seq
MIRT1406642	hsa-miR-558	CLIP-seq
MIRT2343862	hsa-miR-650	CLIP-seq
MIRT1406645	hsa-miR-761	CLIP-seq
MIRT1406618	hsa-miR-3117-5p	CLIP-seq
MIRT2121953	hsa-miR-3144-5p	CLIP-seq
MIRT1406620	hsa-miR-3154	CLIP-seq
MIRT1406621	hsa-miR-3179	CLIP-seq
MIRT1406622	hsa-miR-3185	CLIP-seq
MIRT2692496	hsa-miR-1254	CLIP-seq
MIRT2692497	hsa-miR-1976	CLIP-seq
MIRT2692498	hsa-miR-3116	CLIP-seq
MIRT1406618	hsa-miR-3117-5p	CLIP-seq
MIRT1406619	hsa-miR-3148	CLIP-seq
MIRT1406620	hsa-miR-3154	CLIP-seq
MIRT1406621	hsa-miR-3179	CLIP-seq
MIRT1406622	hsa-miR-3185	CLIP-seq
MIRT1406628	hsa-miR-3688-3p	CLIP-seq
MIRT2692499	hsa-miR-4268	CLIP-seq
MIRT2692500	hsa-miR-4448	CLIP-seq
MIRT1557164	hsa-miR-4722-3p	CLIP-seq
MIRT1406643	hsa-miR-570	CLIP-seq
MIRT2692501	hsa-miR-661	CLIP-seq

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001725	Component	Stress fiber	IBA
GO:0003779	Function	Actin binding	IBA
GO:0003779	Function	Actin binding	IEA
GO:0003779	Function	Actin binding	ISS
GO:0005515	Function	Protein binding	IPI	15841212, 18596123, 26496610, 30021884, 31597702, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	30661770
GO:0005829	Component	Cytosol	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005923	Component	Bicellular tight junction	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0015629	Component	Actin cytoskeleton	IBA
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0015629	Component	Actin cytoskeleton	ISS
GO:0030018	Component	Z disc	IBA
GO:0032233	Process	Positive regulation of actin filament bundle assembly	IBA
GO:0032233	Process	Positive regulation of actin filament bundle assembly	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043197	Component	Dendritic spine	IEA
GO:0043197	Component	Dendritic spine	TAS	15841212
GO:0043204	Component	Perikaryon	IEA
GO:0043226	Component	Organelle	IEA
GO:0045202	Component	Synapse	IEA
GO:0051492	Process	Regulation of stress fiber assembly	ISS
GO:0070161	Component	Anchoring junction	IEA
GO:0097444	Component	Spine apparatus	IBA
GO:0097444	Component	Spine apparatus	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:1905355	Process	Spine apparatus assembly	IBA

MIM	HGNC	e!Ensembl
608155	30672	ENSG00000171992

Q8N3V7

Protein name

Synaptopodin

Protein function

Actin-associated protein that may play a role in modulating actin-based shape and motility of dendritic spines and renal podocyte foot processes. Seems to be essential for the formation of spine apparatuses in spines of telencephalic neurons, wh

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Expressed in cerebral cortex. {ECO:0000269|PubMed:9314539}.

Sequence

MLGPHLPPPPLAPSEGRPTPCAFQIPDGSYRCLALEAEESSGEEGLQGEVGPTDLEEDEG
VSRSGDDSACRVTQGTPQLPKALGIQPPSCSREEQGASQHDDRASQDWDVVKAGQMMTAS
PSPGPGPRVAQKPALGRSTSLTEKDLKEAKARSQQIAAQLTTPPSSNSRGVQLFNRRRQR
VNEFTLESHGQRGQKPSQESLRVLPSSLPGHAPGLSLSSTSLPEPGPPRHPSPQSPDRGV
PGHSMEGYSEEASLLRHLEKVASEEEEVPLVVYLKENAALLTANGLHLSQNREAQQSSPA
PPPAEVHSPAADVNQNLASPSATLTTPTSNSSHNPPATDVNQNPPATVVPQSLPLSSIQQ
NSSEAQLPSNGTGPASKPSTLCADGQPQAPAEEVRCSTLLIDKVSTPATTTSTFSREATL
IPSSRPPASDFMSSSLLIDIQPNTLVVSADQEMSGRAAATTPTKVYSEVHFTLAKPPSVV
NRTARPFGIQAPGGTSQMERSPMLERRHFGEKAPAPQPPSLPDRSPRPQRHIMSRSPMVE
RRMMGQRSPASERRPLGNFTAPPTYTETLSTAPLASWVRSPPSYSVLYPSSDPKSSHLKG
QAVPASKTGILEESMARRGSRKSMFTFVEKPKVTPNPDLLDLVQTADEKRRQRDQGEVGV
EEEPFALGAEASNFQQEPAPRDRASPAAAEEVVPEWASCLKSPRIQAKPKPKPNQNLSEA
SGKGAELYARRQSRMEKYVIESSSHTPELARCPSPTMSLPSSWKYPTNAPGAFRVASRSP
ARTPPASLYHGYLPENGVLRPEPTKQPPYQLRPSLFVLSPIKEPAKVSPRAASPAKPSSL
DLVPNLPKGALPPSPALPRPSRSSPGLYTSPGQDSLQPTAVSPPYGGDISPVSPSRAWSP
RAKQAPRPSFSTRNAGIEAQVWKPSFCFK

Sequence length

929

Interactions

View interactions

	KEGG
	Tight junction

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FOCAL SEGMENTAL GLOMERULOSCLEROSIS	—	CTD, ClinGen	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Focal segmental glomerulosclerosis 8	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Nephrotic syndrome	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYNPO-related disorder	Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (49)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Autism Spectrum Disorder	Autism	Pubtator	31254375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22157816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	32991423	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	30372675	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	21655212, 22629296, 35637650	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	22615747	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	29046486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	29046486	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28154762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	25295576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	LHGDN	16564554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	16628251, 17569780, 19666657, 21997392, 26308082, 31605028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	GENOMICS_ENGLAND_DG	19666657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal Segmental Glomerulosclerosis, Not Otherwise Specified	Focal segmental glomerulosclerosis	BEFREE	19666657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal Segmental Glomerulosclerosis, Not Otherwise Specified	Focal segmental glomerulosclerosis	GENOMICS_ENGLAND_DG	19666657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	11135064, 18336100	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
hypertensive nephropathy	Hypertensive Nephropathy	BEFREE	19131934		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	18685143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	15798086	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	23840712, 27089875, 30255020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	28800743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	28800743	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	29982691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	29982691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	29982691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	29982691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	28887457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22157816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11696420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28887457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	23302718, 27855638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesangial sclerosis diffuse	Diffuse mesangial sclerosis	Pubtator	11135064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	30372675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	25145932, 28179596, 28719912, 30257355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosclerosis	Nephrosclerosis	BEFREE	14569107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosis congenital	Nephrotic syndrome	Pubtator	11135064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosis Lipoid	Nephrotic syndrome	Pubtator	11135064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	17569780		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Obesity	Obesity	BEFREE	31321239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	34743649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	28800743	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11696420	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	26274923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	14633131, 30110567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20385374, 26405221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	26405221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	28154762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	31321239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	34334530	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SYNPO (synaptopodin)