Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	11345
Gene name	GABA type A receptor associated protein like 2
Gene symbol	GABARAPL2
Synonyms (NCBI Gene)	ATG8ATG8CGATE-16GATE16GEF-2GEF2
Chromosome	16
Chromosome location	16q23.1

169

Show/Hide all (169)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028644	hsa-miR-30a-5p	Proteomics	18668040
MIRT049629	hsa-miR-92a-3p	CLASH	23622248
MIRT144591	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT144591	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT1009415	hsa-miR-105	CLIP-seq
MIRT1009416	hsa-miR-1273d	CLIP-seq
MIRT1009417	hsa-miR-145	CLIP-seq
MIRT1009418	hsa-miR-1910	CLIP-seq
MIRT1009419	hsa-miR-1912	CLIP-seq
MIRT1009420	hsa-miR-3125	CLIP-seq
MIRT1009421	hsa-miR-323b-3p	CLIP-seq
MIRT1009422	hsa-miR-34a	CLIP-seq
MIRT1009423	hsa-miR-34c-5p	CLIP-seq
MIRT1009424	hsa-miR-3606	CLIP-seq
MIRT1009425	hsa-miR-3611	CLIP-seq
MIRT1009426	hsa-miR-3647-3p	CLIP-seq
MIRT1009427	hsa-miR-3652	CLIP-seq
MIRT1009428	hsa-miR-3653	CLIP-seq
MIRT1009429	hsa-miR-3658	CLIP-seq
MIRT1009430	hsa-miR-3664-5p	CLIP-seq
MIRT1009431	hsa-miR-369-3p	CLIP-seq
MIRT1009432	hsa-miR-374a	CLIP-seq
MIRT1009433	hsa-miR-374b	CLIP-seq
MIRT1009434	hsa-miR-3908	CLIP-seq
MIRT1009435	hsa-miR-3916	CLIP-seq
MIRT1009436	hsa-miR-3923	CLIP-seq
MIRT1009437	hsa-miR-3928	CLIP-seq
MIRT1009438	hsa-miR-3942-3p	CLIP-seq
MIRT1009439	hsa-miR-4261	CLIP-seq
MIRT1009440	hsa-miR-4264	CLIP-seq
MIRT1009441	hsa-miR-4430	CLIP-seq
MIRT1009442	hsa-miR-4477a	CLIP-seq
MIRT1009443	hsa-miR-4490	CLIP-seq
MIRT1009444	hsa-miR-4496	CLIP-seq
MIRT1009445	hsa-miR-449a	CLIP-seq
MIRT1009446	hsa-miR-449b	CLIP-seq
MIRT1009447	hsa-miR-4501	CLIP-seq
MIRT1009448	hsa-miR-4505	CLIP-seq
MIRT1009449	hsa-miR-4521	CLIP-seq
MIRT1009450	hsa-miR-455-3p	CLIP-seq
MIRT1009451	hsa-miR-4642	CLIP-seq
MIRT1009452	hsa-miR-4699-3p	CLIP-seq
MIRT1009453	hsa-miR-4709-3p	CLIP-seq
MIRT1009454	hsa-miR-4715-5p	CLIP-seq
MIRT1009455	hsa-miR-4731-3p	CLIP-seq
MIRT1009456	hsa-miR-4742-3p	CLIP-seq
MIRT1009457	hsa-miR-4774-5p	CLIP-seq
MIRT1009458	hsa-miR-4794	CLIP-seq
MIRT1009459	hsa-miR-4801	CLIP-seq
MIRT1009460	hsa-miR-498	CLIP-seq
MIRT1009461	hsa-miR-509-3p	CLIP-seq
MIRT1009462	hsa-miR-520d-5p	CLIP-seq
MIRT1009463	hsa-miR-524-5p	CLIP-seq
MIRT1009464	hsa-miR-548a-3p	CLIP-seq
MIRT1009465	hsa-miR-548e	CLIP-seq
MIRT1009466	hsa-miR-548f	CLIP-seq
MIRT1009467	hsa-miR-583	CLIP-seq
MIRT1009468	hsa-miR-605	CLIP-seq
MIRT1009469	hsa-miR-656	CLIP-seq
MIRT1009470	hsa-miR-935	CLIP-seq
MIRT1999104	hsa-miR-1343	CLIP-seq
MIRT1999105	hsa-miR-3074-5p	CLIP-seq
MIRT1009425	hsa-miR-3611	CLIP-seq
MIRT1999106	hsa-miR-3690	CLIP-seq
MIRT1999107	hsa-miR-4254	CLIP-seq
MIRT1999108	hsa-miR-4434	CLIP-seq
MIRT1999109	hsa-miR-4438	CLIP-seq
MIRT1009447	hsa-miR-4501	CLIP-seq
MIRT1999110	hsa-miR-4516	CLIP-seq
MIRT1009449	hsa-miR-4521	CLIP-seq
MIRT1999111	hsa-miR-4531	CLIP-seq
MIRT1009452	hsa-miR-4699-3p	CLIP-seq
MIRT1009453	hsa-miR-4709-3p	CLIP-seq
MIRT1999112	hsa-miR-5095	CLIP-seq
MIRT1009468	hsa-miR-605	CLIP-seq
MIRT1009470	hsa-miR-935	CLIP-seq
MIRT1009415	hsa-miR-105	CLIP-seq
MIRT1009425	hsa-miR-3611	CLIP-seq
MIRT2232798	hsa-miR-374c	CLIP-seq
MIRT1009443	hsa-miR-4490	CLIP-seq
MIRT1009447	hsa-miR-4501	CLIP-seq
MIRT1009453	hsa-miR-4709-3p	CLIP-seq
MIRT1009457	hsa-miR-4774-5p	CLIP-seq
MIRT2232799	hsa-miR-4777-3p	CLIP-seq
MIRT1009462	hsa-miR-520d-5p	CLIP-seq
MIRT1009463	hsa-miR-524-5p	CLIP-seq
MIRT2232800	hsa-miR-655	CLIP-seq
MIRT1009425	hsa-miR-3611	CLIP-seq
MIRT1009447	hsa-miR-4501	CLIP-seq
MIRT1009453	hsa-miR-4709-3p	CLIP-seq
MIRT1009416	hsa-miR-1273d	CLIP-seq
MIRT2437359	hsa-miR-141	CLIP-seq
MIRT1009419	hsa-miR-1912	CLIP-seq
MIRT2437360	hsa-miR-200a	CLIP-seq
MIRT2437361	hsa-miR-4711-5p	CLIP-seq
MIRT1009460	hsa-miR-498	CLIP-seq
MIRT2536397	hsa-miR-1224-5p	CLIP-seq
MIRT1009416	hsa-miR-1273d	CLIP-seq
MIRT1999104	hsa-miR-1343	CLIP-seq
MIRT2437359	hsa-miR-141	CLIP-seq
MIRT1009419	hsa-miR-1912	CLIP-seq
MIRT2437360	hsa-miR-200a	CLIP-seq
MIRT2536398	hsa-miR-204	CLIP-seq
MIRT2536399	hsa-miR-211	CLIP-seq
MIRT1999105	hsa-miR-3074-5p	CLIP-seq
MIRT2536400	hsa-miR-3180-5p	CLIP-seq
MIRT1009430	hsa-miR-3664-5p	CLIP-seq
MIRT1999106	hsa-miR-3690	CLIP-seq
MIRT2536401	hsa-miR-371b-5p	CLIP-seq
MIRT2232798	hsa-miR-374c	CLIP-seq
MIRT1009436	hsa-miR-3923	CLIP-seq
MIRT1999107	hsa-miR-4254	CLIP-seq
MIRT1009439	hsa-miR-4261	CLIP-seq
MIRT1999108	hsa-miR-4434	CLIP-seq
MIRT1999109	hsa-miR-4438	CLIP-seq
MIRT1009444	hsa-miR-4496	CLIP-seq
MIRT1999110	hsa-miR-4516	CLIP-seq
MIRT2536402	hsa-miR-4517	CLIP-seq
MIRT1009449	hsa-miR-4521	CLIP-seq
MIRT1999111	hsa-miR-4531	CLIP-seq
MIRT2536403	hsa-miR-4698	CLIP-seq
MIRT1009452	hsa-miR-4699-3p	CLIP-seq
MIRT2437361	hsa-miR-4711-5p	CLIP-seq
MIRT1009456	hsa-miR-4742-3p	CLIP-seq
MIRT2536404	hsa-miR-4751	CLIP-seq
MIRT2536405	hsa-miR-4755-5p	CLIP-seq
MIRT2232799	hsa-miR-4777-3p	CLIP-seq
MIRT1009460	hsa-miR-498	CLIP-seq
MIRT1999112	hsa-miR-5095	CLIP-seq
MIRT2536406	hsa-miR-520a-5p	CLIP-seq
MIRT2536407	hsa-miR-525-5p	CLIP-seq
MIRT1009464	hsa-miR-548a-3p	CLIP-seq
MIRT2536408	hsa-miR-548ae	CLIP-seq
MIRT2536409	hsa-miR-548aj	CLIP-seq
MIRT2536410	hsa-miR-548am	CLIP-seq
MIRT1009465	hsa-miR-548e	CLIP-seq
MIRT1009466	hsa-miR-548f	CLIP-seq
MIRT2536411	hsa-miR-548x	CLIP-seq
MIRT2536412	hsa-miR-623	CLIP-seq
MIRT2232800	hsa-miR-655	CLIP-seq
MIRT2536413	hsa-miR-888	CLIP-seq
MIRT2536397	hsa-miR-1224-5p	CLIP-seq
MIRT1009416	hsa-miR-1273d	CLIP-seq
MIRT1999104	hsa-miR-1343	CLIP-seq
MIRT2437359	hsa-miR-141	CLIP-seq
MIRT1009419	hsa-miR-1912	CLIP-seq
MIRT2437360	hsa-miR-200a	CLIP-seq
MIRT2536398	hsa-miR-204	CLIP-seq
MIRT2536399	hsa-miR-211	CLIP-seq
MIRT1999105	hsa-miR-3074-5p	CLIP-seq
MIRT2536400	hsa-miR-3180-5p	CLIP-seq
MIRT1999106	hsa-miR-3690	CLIP-seq
MIRT2232798	hsa-miR-374c	CLIP-seq
MIRT1999107	hsa-miR-4254	CLIP-seq
MIRT1999108	hsa-miR-4434	CLIP-seq
MIRT1999109	hsa-miR-4438	CLIP-seq
MIRT1999110	hsa-miR-4516	CLIP-seq
MIRT2536402	hsa-miR-4517	CLIP-seq
MIRT1999111	hsa-miR-4531	CLIP-seq
MIRT2437361	hsa-miR-4711-5p	CLIP-seq
MIRT2536404	hsa-miR-4751	CLIP-seq
MIRT2536405	hsa-miR-4755-5p	CLIP-seq
MIRT2232799	hsa-miR-4777-3p	CLIP-seq
MIRT1009460	hsa-miR-498	CLIP-seq
MIRT1999112	hsa-miR-5095	CLIP-seq
MIRT2536406	hsa-miR-520a-5p	CLIP-seq
MIRT2536407	hsa-miR-525-5p	CLIP-seq
MIRT2536412	hsa-miR-623	CLIP-seq
MIRT2232800	hsa-miR-655	CLIP-seq

Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	IBA
GO:0000139	Component	Golgi membrane	IDA	21669198
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	ISS	10747018, 11414770
GO:0000149	Function	SNARE binding	ISS	10747018
GO:0000421	Component	Autophagosome membrane	IBA
GO:0000421	Component	Autophagosome membrane	IDA	15169837
GO:0000421	Component	Autophagosome membrane	TAS
GO:0000423	Process	Mitophagy	IBA
GO:0005515	Function	Protein binding	IPI	11096062, 11146101, 11825910, 16169070, 16189514, 16303767, 17580304, 19056683, 19250911, 20010802, 20029029, 20200478, 20562859, 21617041, 21669198, 21900206, 22354992, 22421968, 22470510, 24089205, 24668264, 25416956, 25684205, 26040720, 26347139, 28514442, 28712572, 30990354, 315
GO:0005543	Function	Phospholipid binding	IEA
GO:0005737	Component	Cytoplasm	IDA	21669198
GO:0005776	Component	Autophagosome	IDA	19056683, 21669198
GO:0005776	Component	Autophagosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	ISS	11414770
GO:0005829	Component	Cytosol	ISS	11414770
GO:0005829	Component	Cytosol	TAS
GO:0006891	Process	Intra-Golgi vesicle-mediated transport	ISS	10747018
GO:0006914	Process	Autophagy	IEA
GO:0006914	Process	Autophagy	NAS	12507496
GO:0006995	Process	Cellular response to nitrogen starvation	IBA
GO:0008017	Function	Microtubule binding	NAS	11414770
GO:0008429	Function	Phosphatidylethanolamine binding	IBA
GO:0008429	Function	Phosphatidylethanolamine binding	IDA	15169837
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IBA
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	25127057
GO:0032781	Process	Positive regulation of ATP-dependent activity	ISS	10747018
GO:0048487	Function	Beta-tubulin binding	ISS
GO:0050811	Function	GABA receptor binding	ISS
GO:0050811	Function	GABA receptor binding	NAS	11414770
GO:0051117	Function	ATPase binding	ISS	10747018
GO:0070972	Process	Protein localization to endoplasmic reticulum	IDA	30990354
GO:0097352	Process	Autophagosome maturation	IBA
GO:1901799	Process	Negative regulation of proteasomal protein catabolic process	IMP	21669198

MIM	HGNC	e!Ensembl
607452	13291	ENSG00000034713

P60520

Protein name

Gamma-aminobutyric acid receptor-associated protein-like 2 (GABA(A) receptor-associated protein-like 2) (Ganglioside expression factor 2) (GEF-2) (General protein transport factor p16) (Golgi-associated ATPase enhancer of 16 kDa) (GATE-16) (MAP1 light cha

Protein function

Ubiquitin-like modifier involved in intra-Golgi traffic (By similarity). Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation (By similarity). It first stimulates the ATPase activity of NSF which in turn st

PDB

4CO7 , 6H8C , 7LK3 , 7YO8 , 8Q6Q

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02991	Atg8	13 → 116	Autophagy protein Atg8 ubiquitin like	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Expressed at high levels in the brain, heart, prostate, ovary, spleen and skeletal muscle. Expressed at very low levels in lung, thymus and small intestine. {ECO:0000269|PubMed:11146101, ECO:0000269|PubMed:11414770}.

Sequence

MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQF
MWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF

Sequence length

117

Interactions

View interactions

	KEGG		Reactome
	FoxO signaling pathway Autophagy - other Mitophagy - animal Autophagy - animal NOD-like receptor signaling pathway GABAergic synapse		Macroautophagy TBC/RABGAPs

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (20)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	25986473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	35500219	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Diamond-Blackfan	Anemia	BEFREE	30125570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30374741	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	34914033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	32221364	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diamond-Blackfan Anemia 1	Diamond-Blackfan anemia	BEFREE	30125570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia verruciformis	Pubtator	36044516	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32831056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	23891751	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23891751	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	25986473	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	32819149	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29496607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	35802825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32763409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	39528529	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37413850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	40124374	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	37287971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

GABARAPL2 (GABA type A receptor associated protein like 2)