Gene Gene information from NCBI Gene database.
Entrez ID 11338
Gene name U2 small nuclear RNA auxiliary factor 2
Gene symbol U2AF2
Synonyms (NCBI Gene)
DEVDFBU2AF65
Chromosome 19
Chromosome location 19q13.42
Summary U2 auxiliary factor (U2AF), comprised of a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the U2AF large subunit which contains a sequence-specific RNA-binding region w
miRNA miRNA information provided by mirtarbase database.
256
miRTarBase ID miRNA Experiments Reference
MIRT049199 hsa-miR-92a-3p CLASH 23622248
MIRT049199 hsa-miR-92a-3p CLASH 23622248
MIRT049199 hsa-miR-92a-3p CLASH 23622248
MIRT048235 hsa-miR-196a-5p CLASH 23622248
MIRT047003 hsa-miR-210-3p CLASH 23622248
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Transcription factor Regulation Reference
SF1 Unknown 10606272;16376933
WT1 Unknown 9784496
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
37
GO ID Ontology Definition Evidence Reference
GO:0000243 Component Commitment complex IBA
GO:0000245 Process Spliceosomal complex assembly IBA
GO:0000398 Process MRNA splicing, via spliceosome IC 9731529
GO:0000398 Process MRNA splicing, via spliceosome IDA 1824937
GO:0000398 Process MRNA splicing, via spliceosome NAS 17024186, 32343311
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
191318 23156 ENSG00000063244
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P26368
Protein name Splicing factor U2AF 65 kDa subunit (U2 auxiliary factor 65 kDa subunit) (hU2AF(65)) (hU2AF65) (U2 snRNP auxiliary factor large subunit)
Protein function Plays a role in pre-mRNA splicing and 3'-end processing (PubMed:17024186). By recruiting PRPF19 and the PRP19C/Prp19 complex/NTC/Nineteen complex to the RNA polymerase II C-terminal domain (CTD), and thereby pre-mRNA, may couple transcription to
PDB 1JMT , 1O0P , 1OPI , 1U2F , 2G4B , 2HZC , 2M0G , 2U2F , 2YH0 , 2YH1 , 3VAF , 3VAG , 3VAH , 3VAI , 3VAJ , 3VAK , 3VAL , 3VAM , 4FXW , 4TU7 , 4TU8 , 4TU9 , 5EV1 , 5EV2 , 5EV3 , 5EV4 , 5W0G , 5W0H , 6TR0 , 6XLV , 6XLW , 6XLX , 7S3A , 7S3B , 7S3C , 7SN6 , 8P25 , 9C7A , 9C7B , 9DWU
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 151 225 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 261 331 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 399 460 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Sequence
MSDFDEFERQLNENKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRDQRSASRDRRR
RSKPLTRGAKEEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATA
LLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQ
APGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLK
IRRPHDYQPLPGMSE
NPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSK
GYAFCEYVDINVTDQAIAGLNGMQLGDKKLL
VQRASVGAKNATLVSPPSTINQTPVTLQV
PGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRP
VDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVV
TKYCDPDSYHRRDFW
Sequence length 475
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Spliceosome   Transport of Mature mRNA derived from an Intron-Containing Transcript
mRNA Splicing - Major Pathway
mRNA 3'-end processing
RNA Polymerase II Transcription Termination
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
5
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Developmental delay, dysmorphic facies, and brain anomalies Likely pathogenic; Pathogenic rs2123678139, rs1600073584, rs2514215278, rs2514219045 RCV004785440
RCV003333775
RCV006259440
RCV003333894
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Leukodystrophy Likely pathogenic rs2514215337 RCV003318470
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental disorder Likely pathogenic rs2123691990 RCV002249197
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
INSOMNIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
beta Thalassemia Beta thalassemia Pubtator 12189174 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 40264052 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Large Cell Large cell carcinoma Pubtator 26349752 Stimulate
★☆☆☆☆
Found in Text Mining only
Carcinoma Renal Cell Renal cell carcinoma Pubtator 34514002 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Small Cell Small cell carcinoma Pubtator 26349752 Stimulate
★☆☆☆☆
Found in Text Mining only
Carcinoma Squamous Cell Squamous cell carcinoma Pubtator 26349752 Stimulate
★☆☆☆☆
Found in Text Mining only
Colonic Neoplasms Colonic Neoplasms BEFREE 22682314
★☆☆☆☆
Found in Text Mining only
Colonic Neoplasms Colonic neoplasm Pubtator 22682314 Associate
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 22682314
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal Neoplasms BEFREE 22682314
★☆☆☆☆
Found in Text Mining only