Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	11337
Gene name	GABA type A receptor-associated protein
Gene symbol	GABARAP
Synonyms (NCBI Gene)	ATG8AGABARAP-aMM46
Chromosome	17
Chromosome location	17p13.1
Summary	Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. This gene encodes GABA(A) receptor-associated protein, which is highly positively charged in its N-terminus and shares se

226

Show/Hide all (226)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029885	hsa-miR-26b-5p	Microarray	19088304
MIRT459644	hsa-miR-4484	PAR-CLIP	23592263
MIRT459643	hsa-miR-3120-3p	PAR-CLIP	23592263
MIRT459642	hsa-miR-888-3p	PAR-CLIP	23592263
MIRT459641	hsa-miR-4499	PAR-CLIP	23592263
MIRT459640	hsa-miR-6165	PAR-CLIP	23592263
MIRT459639	hsa-miR-2392	PAR-CLIP	23592263
MIRT459638	hsa-miR-4494	PAR-CLIP	23592263
MIRT459637	hsa-miR-214-3p	PAR-CLIP	23592263
MIRT459636	hsa-miR-3619-5p	PAR-CLIP	23592263
MIRT459635	hsa-miR-761	PAR-CLIP	23592263
MIRT459634	hsa-miR-139-5p	PAR-CLIP	23592263
MIRT459633	hsa-miR-4513	PAR-CLIP	23592263
MIRT459632	hsa-miR-6855-3p	PAR-CLIP	23592263
MIRT459631	hsa-miR-4668-5p	PAR-CLIP	23592263
MIRT459630	hsa-miR-3153	PAR-CLIP	23592263
MIRT459629	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT459628	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT459627	hsa-miR-3618	PAR-CLIP	23592263
MIRT459626	hsa-miR-4294	PAR-CLIP	23592263
MIRT727619	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT727618	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT727617	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT727616	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT459644	hsa-miR-4484	PAR-CLIP	23592263
MIRT459643	hsa-miR-3120-3p	PAR-CLIP	23592263
MIRT459642	hsa-miR-888-3p	PAR-CLIP	23592263
MIRT459641	hsa-miR-4499	PAR-CLIP	23592263
MIRT459640	hsa-miR-6165	PAR-CLIP	23592263
MIRT459639	hsa-miR-2392	PAR-CLIP	23592263
MIRT459638	hsa-miR-4494	PAR-CLIP	23592263
MIRT459637	hsa-miR-214-3p	PAR-CLIP	23592263
MIRT459636	hsa-miR-3619-5p	PAR-CLIP	23592263
MIRT459635	hsa-miR-761	PAR-CLIP	23592263
MIRT459634	hsa-miR-139-5p	PAR-CLIP	23592263
MIRT459633	hsa-miR-4513	PAR-CLIP	23592263
MIRT459632	hsa-miR-6855-3p	PAR-CLIP	23592263
MIRT459631	hsa-miR-4668-5p	PAR-CLIP	23592263
MIRT459630	hsa-miR-3153	PAR-CLIP	23592263
MIRT459629	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT459628	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT459627	hsa-miR-3618	PAR-CLIP	23592263
MIRT459626	hsa-miR-4294	PAR-CLIP	23592263
MIRT1009376	hsa-miR-1910	CLIP-seq
MIRT1009377	hsa-miR-196a	CLIP-seq
MIRT1009378	hsa-miR-196b	CLIP-seq
MIRT1009379	hsa-miR-2114	CLIP-seq
MIRT1009380	hsa-miR-214	CLIP-seq
MIRT1009381	hsa-miR-3202	CLIP-seq
MIRT1009382	hsa-miR-3606	CLIP-seq
MIRT1009383	hsa-miR-3613-3p	CLIP-seq
MIRT1009384	hsa-miR-3919	CLIP-seq
MIRT1009385	hsa-miR-4271	CLIP-seq
MIRT1009386	hsa-miR-4428	CLIP-seq
MIRT1009387	hsa-miR-4476	CLIP-seq
MIRT1009388	hsa-miR-4501	CLIP-seq
MIRT1009389	hsa-miR-4504	CLIP-seq
MIRT1009390	hsa-miR-455-3p	CLIP-seq
MIRT1009391	hsa-miR-4640-3p	CLIP-seq
MIRT1009392	hsa-miR-4667-3p	CLIP-seq
MIRT1009393	hsa-miR-4725-3p	CLIP-seq
MIRT1009394	hsa-miR-4764-5p	CLIP-seq
MIRT1009395	hsa-miR-488	CLIP-seq
MIRT1009396	hsa-miR-542-3p	CLIP-seq
MIRT1009397	hsa-miR-642b	CLIP-seq
MIRT1009398	hsa-miR-885-5p	CLIP-seq
MIRT1549121	hsa-miR-1252	CLIP-seq
MIRT1549122	hsa-miR-3173-3p	CLIP-seq
MIRT1549123	hsa-miR-371-3p	CLIP-seq
MIRT1549124	hsa-miR-4635	CLIP-seq
MIRT1999090	hsa-miR-1238	CLIP-seq
MIRT1999091	hsa-miR-1243	CLIP-seq
MIRT1999092	hsa-miR-185	CLIP-seq
MIRT1009380	hsa-miR-214	CLIP-seq
MIRT1999093	hsa-miR-3135b	CLIP-seq
MIRT1999094	hsa-miR-34b	CLIP-seq
MIRT1999095	hsa-miR-3652	CLIP-seq
MIRT1009384	hsa-miR-3919	CLIP-seq
MIRT1009385	hsa-miR-4271	CLIP-seq
MIRT1999096	hsa-miR-4306	CLIP-seq
MIRT1009386	hsa-miR-4428	CLIP-seq
MIRT1999097	hsa-miR-4430	CLIP-seq
MIRT1009388	hsa-miR-4501	CLIP-seq
MIRT1009389	hsa-miR-4504	CLIP-seq
MIRT1999098	hsa-miR-455-5p	CLIP-seq
MIRT1999099	hsa-miR-4644	CLIP-seq
MIRT1009392	hsa-miR-4667-3p	CLIP-seq
MIRT1999100	hsa-miR-4705	CLIP-seq
MIRT1009393	hsa-miR-4725-3p	CLIP-seq
MIRT1009394	hsa-miR-4764-5p	CLIP-seq
MIRT1999101	hsa-miR-485-5p	CLIP-seq
MIRT1009396	hsa-miR-542-3p	CLIP-seq
MIRT1999102	hsa-miR-550a	CLIP-seq
MIRT1009397	hsa-miR-642b	CLIP-seq
MIRT1999103	hsa-miR-876-3p	CLIP-seq
MIRT1999090	hsa-miR-1238	CLIP-seq
MIRT1999091	hsa-miR-1243	CLIP-seq
MIRT1549121	hsa-miR-1252	CLIP-seq
MIRT1009380	hsa-miR-214	CLIP-seq
MIRT1549122	hsa-miR-3173-3p	CLIP-seq
MIRT2232762	hsa-miR-3183	CLIP-seq
MIRT2232763	hsa-miR-323-5p	CLIP-seq
MIRT1999094	hsa-miR-34b	CLIP-seq
MIRT2232764	hsa-miR-3653	CLIP-seq
MIRT2232765	hsa-miR-3658	CLIP-seq
MIRT2232766	hsa-miR-3674	CLIP-seq
MIRT1549123	hsa-miR-371-3p	CLIP-seq
MIRT1009384	hsa-miR-3919	CLIP-seq
MIRT2232767	hsa-miR-4267	CLIP-seq
MIRT1009385	hsa-miR-4271	CLIP-seq
MIRT1009386	hsa-miR-4428	CLIP-seq
MIRT1009388	hsa-miR-4501	CLIP-seq
MIRT1009389	hsa-miR-4504	CLIP-seq
MIRT1999098	hsa-miR-455-5p	CLIP-seq
MIRT1999100	hsa-miR-4705	CLIP-seq
MIRT2232768	hsa-miR-4723-3p	CLIP-seq
MIRT1009393	hsa-miR-4725-3p	CLIP-seq
MIRT2232769	hsa-miR-4753-3p	CLIP-seq
MIRT1009394	hsa-miR-4764-5p	CLIP-seq
MIRT2232770	hsa-miR-4786-5p	CLIP-seq
MIRT1009396	hsa-miR-542-3p	CLIP-seq
MIRT1009397	hsa-miR-642b	CLIP-seq
MIRT2232771	hsa-miR-765	CLIP-seq
MIRT2232772	hsa-miR-766	CLIP-seq
MIRT2232773	hsa-miR-769-5p	CLIP-seq
MIRT1999103	hsa-miR-876-3p	CLIP-seq
MIRT1009398	hsa-miR-885-5p	CLIP-seq
MIRT1009380	hsa-miR-214	CLIP-seq
MIRT1009380	hsa-miR-214	CLIP-seq
MIRT1009380	hsa-miR-214	CLIP-seq
MIRT2536287	hsa-miR-1225-3p	CLIP-seq
MIRT2536288	hsa-miR-1233	CLIP-seq
MIRT1999091	hsa-miR-1243	CLIP-seq
MIRT1549121	hsa-miR-1252	CLIP-seq
MIRT2536289	hsa-miR-1266	CLIP-seq
MIRT1999092	hsa-miR-185	CLIP-seq
MIRT1009377	hsa-miR-196a	CLIP-seq
MIRT1009378	hsa-miR-196b	CLIP-seq
MIRT1009380	hsa-miR-214	CLIP-seq
MIRT1999093	hsa-miR-3135b	CLIP-seq
MIRT2536290	hsa-miR-3170	CLIP-seq
MIRT1549122	hsa-miR-3173-3p	CLIP-seq
MIRT2536291	hsa-miR-3189-3p	CLIP-seq
MIRT1009381	hsa-miR-3202	CLIP-seq
MIRT1999094	hsa-miR-34b	CLIP-seq
MIRT1009382	hsa-miR-3606	CLIP-seq
MIRT1009383	hsa-miR-3613-3p	CLIP-seq
MIRT1999095	hsa-miR-3652	CLIP-seq
MIRT2232764	hsa-miR-3653	CLIP-seq
MIRT2232765	hsa-miR-3658	CLIP-seq
MIRT1549123	hsa-miR-371-3p	CLIP-seq
MIRT1009384	hsa-miR-3919	CLIP-seq
MIRT2232767	hsa-miR-4267	CLIP-seq
MIRT1009385	hsa-miR-4271	CLIP-seq
MIRT2536292	hsa-miR-4303	CLIP-seq
MIRT1999096	hsa-miR-4306	CLIP-seq
MIRT1009386	hsa-miR-4428	CLIP-seq
MIRT1999097	hsa-miR-4430	CLIP-seq
MIRT1009387	hsa-miR-4476	CLIP-seq
MIRT1009388	hsa-miR-4501	CLIP-seq
MIRT1009389	hsa-miR-4504	CLIP-seq
MIRT2536293	hsa-miR-4518	CLIP-seq
MIRT1549124	hsa-miR-4635	CLIP-seq
MIRT1009391	hsa-miR-4640-3p	CLIP-seq
MIRT1999099	hsa-miR-4644	CLIP-seq
MIRT1009392	hsa-miR-4667-3p	CLIP-seq
MIRT2536294	hsa-miR-4688	CLIP-seq
MIRT1999100	hsa-miR-4705	CLIP-seq
MIRT1009393	hsa-miR-4725-3p	CLIP-seq
MIRT2536295	hsa-miR-4731-5p	CLIP-seq
MIRT1009394	hsa-miR-4764-5p	CLIP-seq
MIRT2232770	hsa-miR-4786-5p	CLIP-seq
MIRT1999101	hsa-miR-485-5p	CLIP-seq
MIRT2536296	hsa-miR-486-3p	CLIP-seq
MIRT1009395	hsa-miR-488	CLIP-seq
MIRT1009396	hsa-miR-542-3p	CLIP-seq
MIRT2536297	hsa-miR-635	CLIP-seq
MIRT1009397	hsa-miR-642b	CLIP-seq
MIRT2536298	hsa-miR-646	CLIP-seq
MIRT2232771	hsa-miR-765	CLIP-seq
MIRT2232772	hsa-miR-766	CLIP-seq
MIRT2232773	hsa-miR-769-5p	CLIP-seq
MIRT1009398	hsa-miR-885-5p	CLIP-seq
MIRT2536287	hsa-miR-1225-3p	CLIP-seq
MIRT2536288	hsa-miR-1233	CLIP-seq
MIRT1999091	hsa-miR-1243	CLIP-seq
MIRT1549121	hsa-miR-1252	CLIP-seq
MIRT2536289	hsa-miR-1266	CLIP-seq
MIRT1999092	hsa-miR-185	CLIP-seq
MIRT1009380	hsa-miR-214	CLIP-seq
MIRT1999093	hsa-miR-3135b	CLIP-seq
MIRT1549122	hsa-miR-3173-3p	CLIP-seq
MIRT2536291	hsa-miR-3189-3p	CLIP-seq
MIRT1999094	hsa-miR-34b	CLIP-seq
MIRT1999095	hsa-miR-3652	CLIP-seq
MIRT2232764	hsa-miR-3653	CLIP-seq
MIRT2232765	hsa-miR-3658	CLIP-seq
MIRT1549123	hsa-miR-371-3p	CLIP-seq
MIRT1009384	hsa-miR-3919	CLIP-seq
MIRT2232767	hsa-miR-4267	CLIP-seq
MIRT1009385	hsa-miR-4271	CLIP-seq
MIRT2536292	hsa-miR-4303	CLIP-seq
MIRT1999096	hsa-miR-4306	CLIP-seq
MIRT1009386	hsa-miR-4428	CLIP-seq
MIRT1999097	hsa-miR-4430	CLIP-seq
MIRT1009388	hsa-miR-4501	CLIP-seq
MIRT1009389	hsa-miR-4504	CLIP-seq
MIRT2536293	hsa-miR-4518	CLIP-seq
MIRT1549124	hsa-miR-4635	CLIP-seq
MIRT1999099	hsa-miR-4644	CLIP-seq
MIRT1009392	hsa-miR-4667-3p	CLIP-seq
MIRT2536294	hsa-miR-4688	CLIP-seq
MIRT1999100	hsa-miR-4705	CLIP-seq
MIRT1009393	hsa-miR-4725-3p	CLIP-seq
MIRT1009394	hsa-miR-4764-5p	CLIP-seq
MIRT2232770	hsa-miR-4786-5p	CLIP-seq
MIRT1999101	hsa-miR-485-5p	CLIP-seq
MIRT2536296	hsa-miR-486-3p	CLIP-seq
MIRT1009396	hsa-miR-542-3p	CLIP-seq
MIRT2536297	hsa-miR-635	CLIP-seq
MIRT1009397	hsa-miR-642b	CLIP-seq
MIRT2536298	hsa-miR-646	CLIP-seq
MIRT2232771	hsa-miR-765	CLIP-seq
MIRT2232772	hsa-miR-766	CLIP-seq
MIRT2232773	hsa-miR-769-5p	CLIP-seq
MIRT1009398	hsa-miR-885-5p	CLIP-seq

Show/Hide all (51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	IBA
GO:0000139	Component	Golgi membrane	IEA
GO:0000226	Process	Microtubule cytoskeleton organization	IEA
GO:0000421	Component	Autophagosome membrane	IBA
GO:0000421	Component	Autophagosome membrane	IDA	15169837
GO:0000421	Component	Autophagosome membrane	IEA
GO:0000421	Component	Autophagosome membrane	TAS
GO:0000423	Process	Mitophagy	IBA
GO:0005515	Function	Protein binding	IPI	9892355, 11096062, 11146101, 15977068, 16169070, 16303767, 17580304, 19056683, 19154346, 19250911, 20010802, 20200478, 20452972, 20562859, 20810658, 21617041, 22267086, 22354992, 22421968, 22470510, 22948227, 24089205, 24290141, 24879152, 25126726, 25127057, 25500191, 25684205, 2604
GO:0005543	Function	Phospholipid binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005776	Component	Autophagosome	IDA	19056683
GO:0005776	Component	Autophagosome	IEA
GO:0005790	Component	Smooth endoplasmic reticulum	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0005875	Component	Microtubule associated complex	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9892355
GO:0005930	Component	Axoneme	IEA
GO:0005930	Component	Axoneme	ISS
GO:0006605	Process	Protein targeting	TAS	9892355
GO:0006914	Process	Autophagy	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006995	Process	Cellular response to nitrogen starvation	IBA
GO:0007268	Process	Chemical synaptic transmission	TAS	9892355
GO:0008017	Function	Microtubule binding	IEA
GO:0008429	Function	Phosphatidylethanolamine binding	IBA
GO:0008429	Function	Phosphatidylethanolamine binding	IDA	15169837
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IDA	15977068
GO:0012505	Component	Endomembrane system	IEA
GO:0015031	Process	Protein transport	IEA
GO:0015629	Component	Actin cytoskeleton	IEA
GO:0016020	Component	Membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IBA
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	25127057
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	25684205
GO:0035020	Process	Regulation of Rac protein signal transduction	IMP	25684205
GO:0048487	Function	Beta-tubulin binding	IDA	9892355
GO:0050811	Function	GABA receptor binding	IBA
GO:0050811	Function	GABA receptor binding	IPI	9892355
GO:0097225	Component	Sperm midpiece	IEA
GO:0097352	Process	Autophagosome maturation	IBA
GO:0098696	Process	Regulation of neurotransmitter receptor localization to postsynaptic specialization membrane	IEA
GO:0098982	Component	GABA-ergic synapse	IEA
GO:1902524	Process	Positive regulation of protein K48-linked ubiquitination	IMP	25684205

MIM	HGNC	e!Ensembl
605125	4067	ENSG00000170296

O95166

Protein name

Gamma-aminobutyric acid receptor-associated protein (GABA(A) receptor-associated protein) (MM46)

Protein function

Ubiquitin-like modifier that plays a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton (PubMed:9892355). Involved in autophagy: while LC3s are involved in elongation of the phagophore membrane, the GA

PDB

1GNU , 1KLV , 1KM7 , 1KOT , 3D32 , 3DOW , 3WIM , 4XC2 , 5DPS , 6HB9 , 6HOG , 6HOH , 6HOJ , 6HOK , 6HYL , 6HYM , 6HYN , 6HYO , 6YOP , 7AA8 , 7BRQ , 7BRT , 7BRU , 7BV4 , 7EA7 , 7LSW , 7LT6 , 7VEC , 7VED , 7YO9 , 7ZKR , 7ZL7 , 8AFI , 8S1M , 8T2M , 8T2N , 8T31 , 8T32 , 8T33 , 8W6A

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02991	Atg8	13 → 116	Autophagy protein Atg8 ubiquitin like	Domain

Tissue specificity

TISSUE SPECIFICITY: Heart, brain, placenta, liver, skeletal muscle, kidney and pancreas. {ECO:0000269|PubMed:11146101, ECO:0000269|PubMed:9892355}.

Sequence

MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL

Sequence length

117

Interactions

View interactions

	KEGG		Reactome
	FoxO signaling pathway Autophagy - other Mitophagy - animal Autophagy - animal NOD-like receptor signaling pathway GABAergic synapse		Macroautophagy TBC/RABGAPs

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (46)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	22691495, 33218044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angelman Syndrome	Angelman syndrome	Pubtator	18477280	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	19842164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	16556609, 21901839	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	28117838	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15695379, 26474850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26474850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19381877, 23617850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35054896	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37701987	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30374741	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31020644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	19842164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	33827531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	20111057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	21390307, 29873705, 34740144, 37628589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	15218107	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	29563863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized Epilepsy With Febrile Seizures Plus Type 1	Generalized epilepsy with febrile seizures plus	Pubtator	19054398	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33111629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	20111057, 28413119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Sensory and Autonomic Neuropathies	Hereditary sensory and autonomic neuropathy	BEFREE	31032711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Sensory Autonomic Neuropathy, Type 1	Hereditary sensory and autonomic neuropathy	BEFREE	30773365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	37441602	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	23663378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	37999976	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	23891751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	31625269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	BEFREE	25123844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15695379, 26474850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30443548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15695379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental impairment	Mental Depression	BEFREE	19617690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	21205078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	24022508	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15695379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29989488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	27845161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett syndrome	Pubtator	30829465	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	24365204		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	24365204		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizures	Seizures	Pubtator	15857448, 23663378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizures Febrile	Seizures	Pubtator	12086636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stiff-Person Syndrome	Stiff-Person Syndrome	BEFREE	29097081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	19381877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	19381877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

GABARAP (GABA type A receptor-associated protein)