Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	11336
Gene name	Exocyst complex component 3
Gene symbol	EXOC3
Synonyms (NCBI Gene)	SEC6SEC6L1Sec6p
Chromosome	5
Chromosome location	5p15.33
Summary	The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and f

105

Show/Hide all (105)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020798	hsa-miR-155-5p	Proteomics	18668040
MIRT023900	hsa-miR-1-3p	Proteomics	18668040
MIRT025819	hsa-miR-7-5p	Microarray	19073608
MIRT972575	hsa-miR-1207-3p	CLIP-seq
MIRT972576	hsa-miR-1471	CLIP-seq
MIRT972577	hsa-miR-3184	CLIP-seq
MIRT972578	hsa-miR-3926	CLIP-seq
MIRT972579	hsa-miR-423-5p	CLIP-seq
MIRT972580	hsa-miR-4428	CLIP-seq
MIRT972581	hsa-miR-4449	CLIP-seq
MIRT972582	hsa-miR-4649-5p	CLIP-seq
MIRT972583	hsa-miR-4711-5p	CLIP-seq
MIRT972584	hsa-miR-4744	CLIP-seq
MIRT972585	hsa-miR-485-5p	CLIP-seq
MIRT972586	hsa-miR-548s	CLIP-seq
MIRT972587	hsa-miR-548u	CLIP-seq
MIRT972588	hsa-miR-663b	CLIP-seq
MIRT972575	hsa-miR-1207-3p	CLIP-seq
MIRT1988133	hsa-miR-1301	CLIP-seq
MIRT972576	hsa-miR-1471	CLIP-seq
MIRT1988134	hsa-miR-1973	CLIP-seq
MIRT972578	hsa-miR-3926	CLIP-seq
MIRT1988135	hsa-miR-3944-5p	CLIP-seq
MIRT972580	hsa-miR-4428	CLIP-seq
MIRT972581	hsa-miR-4449	CLIP-seq
MIRT1988136	hsa-miR-4660	CLIP-seq
MIRT972584	hsa-miR-4744	CLIP-seq
MIRT1988137	hsa-miR-5047	CLIP-seq
MIRT972586	hsa-miR-548s	CLIP-seq
MIRT972587	hsa-miR-548u	CLIP-seq
MIRT1988138	hsa-miR-644	CLIP-seq
MIRT972588	hsa-miR-663b	CLIP-seq
MIRT2222627	hsa-miR-1233	CLIP-seq
MIRT1988133	hsa-miR-1301	CLIP-seq
MIRT2222628	hsa-miR-147b	CLIP-seq
MIRT1988134	hsa-miR-1973	CLIP-seq
MIRT2222629	hsa-miR-3130-3p	CLIP-seq
MIRT2222630	hsa-miR-3173-5p	CLIP-seq
MIRT2222631	hsa-miR-3689d	CLIP-seq
MIRT1988135	hsa-miR-3944-5p	CLIP-seq
MIRT1988136	hsa-miR-4660	CLIP-seq
MIRT972584	hsa-miR-4744	CLIP-seq
MIRT972585	hsa-miR-485-5p	CLIP-seq
MIRT1988137	hsa-miR-5047	CLIP-seq
MIRT972587	hsa-miR-548u	CLIP-seq
MIRT972575	hsa-miR-1207-3p	CLIP-seq
MIRT2526260	hsa-miR-1207-5p	CLIP-seq
MIRT1988133	hsa-miR-1301	CLIP-seq
MIRT972576	hsa-miR-1471	CLIP-seq
MIRT1988134	hsa-miR-1973	CLIP-seq
MIRT972577	hsa-miR-3184	CLIP-seq
MIRT2526261	hsa-miR-3714	CLIP-seq
MIRT972578	hsa-miR-3926	CLIP-seq
MIRT1988135	hsa-miR-3944-5p	CLIP-seq
MIRT972579	hsa-miR-423-5p	CLIP-seq
MIRT2526262	hsa-miR-4263	CLIP-seq
MIRT972580	hsa-miR-4428	CLIP-seq
MIRT2526263	hsa-miR-4436b-3p	CLIP-seq
MIRT972581	hsa-miR-4449	CLIP-seq
MIRT2526264	hsa-miR-4484	CLIP-seq
MIRT2526265	hsa-miR-4509	CLIP-seq
MIRT972582	hsa-miR-4649-5p	CLIP-seq
MIRT1988136	hsa-miR-4660	CLIP-seq
MIRT972584	hsa-miR-4744	CLIP-seq
MIRT2526266	hsa-miR-4763-3p	CLIP-seq
MIRT2526267	hsa-miR-4799-5p	CLIP-seq
MIRT972585	hsa-miR-485-5p	CLIP-seq
MIRT1988137	hsa-miR-5047	CLIP-seq
MIRT2526268	hsa-miR-548an	CLIP-seq
MIRT972586	hsa-miR-548s	CLIP-seq
MIRT972587	hsa-miR-548u	CLIP-seq
MIRT2526269	hsa-miR-576-5p	CLIP-seq
MIRT1988138	hsa-miR-644	CLIP-seq
MIRT972588	hsa-miR-663b	CLIP-seq
MIRT2526270	hsa-miR-940	CLIP-seq
MIRT972575	hsa-miR-1207-3p	CLIP-seq
MIRT2526260	hsa-miR-1207-5p	CLIP-seq
MIRT1988133	hsa-miR-1301	CLIP-seq
MIRT972576	hsa-miR-1471	CLIP-seq
MIRT1988134	hsa-miR-1973	CLIP-seq
MIRT972577	hsa-miR-3184	CLIP-seq
MIRT2526261	hsa-miR-3714	CLIP-seq
MIRT972578	hsa-miR-3926	CLIP-seq
MIRT1988135	hsa-miR-3944-5p	CLIP-seq
MIRT972579	hsa-miR-423-5p	CLIP-seq
MIRT2526262	hsa-miR-4263	CLIP-seq
MIRT972580	hsa-miR-4428	CLIP-seq
MIRT2526263	hsa-miR-4436b-3p	CLIP-seq
MIRT972581	hsa-miR-4449	CLIP-seq
MIRT2526264	hsa-miR-4484	CLIP-seq
MIRT2526265	hsa-miR-4509	CLIP-seq
MIRT972582	hsa-miR-4649-5p	CLIP-seq
MIRT1988136	hsa-miR-4660	CLIP-seq
MIRT972584	hsa-miR-4744	CLIP-seq
MIRT2526266	hsa-miR-4763-3p	CLIP-seq
MIRT2526267	hsa-miR-4799-5p	CLIP-seq
MIRT972585	hsa-miR-485-5p	CLIP-seq
MIRT1988137	hsa-miR-5047	CLIP-seq
MIRT2526268	hsa-miR-548an	CLIP-seq
MIRT972586	hsa-miR-548s	CLIP-seq
MIRT972587	hsa-miR-548u	CLIP-seq
MIRT2526269	hsa-miR-576-5p	CLIP-seq
MIRT1988138	hsa-miR-644	CLIP-seq
MIRT972588	hsa-miR-663b	CLIP-seq
MIRT2526270	hsa-miR-940	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000145	Component	Exocyst	IBA
GO:0000145	Component	Exocyst	IEA
GO:0000145	Component	Exocyst	NAS	22420621
GO:0000149	Function	SNARE binding	IBA
GO:0000281	Process	Mitotic cytokinesis	NAS	22420621
GO:0005515	Function	Protein binding	IPI	18329369, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006887	Process	Exocytosis	IBA
GO:0006887	Process	Exocytosis	IEA
GO:0006904	Process	Vesicle docking involved in exocytosis	NAS	22420621
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0030426	Component	Growth cone	IEA
GO:0030496	Component	Midbody	IEA
GO:0030667	Component	Secretory granule membrane	TAS
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051601	Process	Exocyst localization	IBA
GO:0090148	Process	Membrane fission	NAS	22420621
GO:0090522	Process	Vesicle tethering involved in exocytosis	NAS	22420621

MIM	HGNC	e!Ensembl
608186	30378	ENSG00000180104

O60645

Protein name

Exocyst complex component 3 (Exocyst complex component Sec6)

Protein function

Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06046	Sec6	177 → 733	Exocyst complex component Sec6	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in epididymis (at protein level). {ECO:0000269|PubMed:20736409}.

Sequence

MKETDREAVATAVQRVAGMLQRPDQLDKVEQYRRREARKKASVEARLKAAIQSQLDGVRT
GLSQLHNALNDVKDIQQSLADVSKDWRQSINTIESLKDVKDAVVQHSQLAAAVENLKNIF
SVPEIVRETQDLIEQGALLQAHRKLMDLECSRDGLMYEQYRMDSGNTRDMTLIHGYFGST
QGLSDELAKQLWMVLQRSLVTVRRDPTLLVSVVRIIEREEKIDRRILDRKKQTGFVPPGR
PKNWKEKMFTILERTVTTRIEGTQADTRESDKMWLVRHLEIIRKYVLDDLIVAKNLMVQC
FPPHYEIFKNLLNMYHQALSTRMQDLASEDLEANEIVSLLTWVLNTYTSTEMMRNVELAP
EVDVGTLEPLLSPHVVSELLDTYMSTLTSNIIAWLRKALETDKKDWVKETEPEADQDGYY
QTTLPAIVFQMFEQNLQVAAQISEDLKTKVLVLCLQQMNSFLSRYKDEAQLYKEEHLRNR
QHPHCYVQYMIAIINNCQTFKESIVSLKRKYLKNEVEEGVSPSQPSMDGILDAIAKEGCS
GLLEEVFLDLEQHLNELMTKKWLLGSNAVDIICVTVEDYFNDFAKIKKPYKKRMTAEAHR
RVVVEYLRAVMQKRISFRSPEERKEGAEKMVREAEQLRFLFRKLASGFGEDVDGYCDTIV
AVAEVIKLTDPSLLYLEVSTLVSKYPDIRDDHIGALLAVRGDASRDMKQTIMETLEQGPA
QASPSYVPLFKDIVVPSLNVAKLLK

Sequence length

745

Interactions

View interactions

	Reactome
			Insulin processing VxPx cargo-targeting to cilium

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOSPADIAS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Barrett Esophagus	Barrett esophagus	Pubtator	35709760	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36134447	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Disease Of Lung	Cystic lung disease	Pubtator	33253230	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	36134447	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	GWASCAT_DG	25108383		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	26892009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	10747091	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

EXOC3 (exocyst complex component 3)