Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	11334
Gene name	Tumor suppressor 2, mitochondrial calcium regulator
Gene symbol	TUSC2
Synonyms (NCBI Gene)	C3orf11FUS1PAPPDAP2
Chromosome	3
Chromosome location	3p21.31
Summary	This gene is a highly conserved lung cancer candidate gene. No other information about this gene is currently available. [provided by RefSeq, Jul 2008]

508

Show/Hide all (508)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003753	hsa-miR-378a-5p	Luciferase reporter assayWestern blotqRT-PCR	18077375
MIRT003753	hsa-miR-378a-5p	Luciferase reporter assayWestern blotqRT-PCR	18077375
MIRT004410	hsa-miR-93-5p	Luciferase reporter assayWestern blot	19671678
MIRT004411	hsa-miR-98-5p	Luciferase reporter assayWestern blot	19671678
MIRT004412	hsa-miR-197-3p	Luciferase reporter assayWestern blot	19671678
MIRT004423	hsa-miR-378a-3p	Review	19935707
MIRT004412	hsa-miR-197-3p	Luciferase reporter assay	19671678
MIRT004410	hsa-miR-93-5p	Luciferase reporter assay	19671678
MIRT004411	hsa-miR-98-5p	Review	20130964
MIRT004412	hsa-miR-197-3p	Review	20130964
MIRT004410	hsa-miR-93-5p	Review	20130964
MIRT004959	hsa-let-7a-5p	qRT-PCR	17942906
MIRT004411	hsa-miR-98-5p	qRT-PCR	17942906
MIRT002528	hsa-miR-373-3p	Microarray	15685193
MIRT004423	hsa-miR-378a-3p	Reporter assay	18077375
MIRT002528	hsa-miR-373-3p	Microarray;Other	15685193
MIRT021769	hsa-miR-132-3p	Microarray	17612493
MIRT025636	hsa-miR-7-5p	Microarray	17612493
MIRT004410	hsa-miR-93-5p	Sequencing	20371350
MIRT049184	hsa-miR-92a-3p	CLASH	23622248
MIRT040404	hsa-miR-615-3p	CLASH	23622248
MIRT004412	hsa-miR-197-3p	Next Generation Sequencing (NGS)	27866223
MIRT1464104	hsa-let-7a	CLIP-seq
MIRT1464105	hsa-let-7b	CLIP-seq
MIRT1464106	hsa-let-7c	CLIP-seq
MIRT1464107	hsa-let-7d	CLIP-seq
MIRT1464108	hsa-let-7e	CLIP-seq
MIRT1464109	hsa-let-7f	CLIP-seq
MIRT1464110	hsa-let-7g	CLIP-seq
MIRT1464111	hsa-let-7i	CLIP-seq
MIRT1464112	hsa-miR-106a	CLIP-seq
MIRT1464113	hsa-miR-106b	CLIP-seq
MIRT1464114	hsa-miR-1183	CLIP-seq
MIRT1464115	hsa-miR-1251	CLIP-seq
MIRT1464116	hsa-miR-1252	CLIP-seq
MIRT1464117	hsa-miR-1260	CLIP-seq
MIRT1464118	hsa-miR-1260b	CLIP-seq
MIRT1464119	hsa-miR-1273e	CLIP-seq
MIRT1464120	hsa-miR-1293	CLIP-seq
MIRT1464121	hsa-miR-1321	CLIP-seq
MIRT1464122	hsa-miR-154	CLIP-seq
MIRT1464123	hsa-miR-17	CLIP-seq
MIRT1464124	hsa-miR-188-3p	CLIP-seq
MIRT1464125	hsa-miR-1909	CLIP-seq
MIRT1464126	hsa-miR-1913	CLIP-seq
MIRT1464127	hsa-miR-203	CLIP-seq
MIRT1464128	hsa-miR-20a	CLIP-seq
MIRT1464129	hsa-miR-20b	CLIP-seq
MIRT1464130	hsa-miR-224	CLIP-seq
MIRT1464131	hsa-miR-23a	CLIP-seq
MIRT1464132	hsa-miR-23b	CLIP-seq
MIRT1464133	hsa-miR-23c	CLIP-seq
MIRT1464134	hsa-miR-2681	CLIP-seq
MIRT1464135	hsa-miR-302a	CLIP-seq
MIRT1464136	hsa-miR-302b	CLIP-seq
MIRT1464137	hsa-miR-302c	CLIP-seq
MIRT1464138	hsa-miR-302d	CLIP-seq
MIRT1464139	hsa-miR-302e	CLIP-seq
MIRT1464140	hsa-miR-3115	CLIP-seq
MIRT1464141	hsa-miR-3135	CLIP-seq
MIRT1464142	hsa-miR-3136-5p	CLIP-seq
MIRT1464143	hsa-miR-3137	CLIP-seq
MIRT1464144	hsa-miR-3140-5p	CLIP-seq
MIRT1464145	hsa-miR-3156-3p	CLIP-seq
MIRT1464146	hsa-miR-3179	CLIP-seq
MIRT1464147	hsa-miR-3194-3p	CLIP-seq
MIRT1464148	hsa-miR-3200-3p	CLIP-seq
MIRT1464149	hsa-miR-324-3p	CLIP-seq
MIRT1464150	hsa-miR-337-5p	CLIP-seq
MIRT1464151	hsa-miR-342-5p	CLIP-seq
MIRT1464152	hsa-miR-345	CLIP-seq
MIRT1464153	hsa-miR-3609	CLIP-seq
MIRT1464154	hsa-miR-361-3p	CLIP-seq
MIRT1464155	hsa-miR-3652	CLIP-seq
MIRT1464156	hsa-miR-3689a-3p	CLIP-seq
MIRT1464157	hsa-miR-3689c	CLIP-seq
MIRT1464158	hsa-miR-372	CLIP-seq
MIRT1464159	hsa-miR-373	CLIP-seq
MIRT1464160	hsa-miR-3913-3p	CLIP-seq
MIRT1464161	hsa-miR-3936	CLIP-seq
MIRT1464162	hsa-miR-4313	CLIP-seq
MIRT1464163	hsa-miR-4327	CLIP-seq
MIRT1464164	hsa-miR-4422	CLIP-seq
MIRT1464165	hsa-miR-4430	CLIP-seq
MIRT1464166	hsa-miR-4439	CLIP-seq
MIRT1464167	hsa-miR-4447	CLIP-seq
MIRT1464168	hsa-miR-4458	CLIP-seq
MIRT1464169	hsa-miR-4459	CLIP-seq
MIRT1464170	hsa-miR-4470	CLIP-seq
MIRT1464171	hsa-miR-4472	CLIP-seq
MIRT1464172	hsa-miR-4475	CLIP-seq
MIRT1464173	hsa-miR-4481	CLIP-seq
MIRT1464174	hsa-miR-4483	CLIP-seq
MIRT1464175	hsa-miR-4492	CLIP-seq
MIRT1464176	hsa-miR-4494	CLIP-seq
MIRT1464177	hsa-miR-4498	CLIP-seq
MIRT1464178	hsa-miR-4500	CLIP-seq
MIRT1464179	hsa-miR-4513	CLIP-seq
MIRT1464180	hsa-miR-4522	CLIP-seq
MIRT1464181	hsa-miR-4528	CLIP-seq
MIRT1464182	hsa-miR-4529-5p	CLIP-seq
MIRT1464183	hsa-miR-4640-5p	CLIP-seq
MIRT1464184	hsa-miR-4645-5p	CLIP-seq
MIRT1464185	hsa-miR-4651	CLIP-seq
MIRT1464186	hsa-miR-4664-5p	CLIP-seq
MIRT1464187	hsa-miR-4673	CLIP-seq
MIRT1464188	hsa-miR-4688	CLIP-seq
MIRT1464189	hsa-miR-4690-5p	CLIP-seq
MIRT1464190	hsa-miR-4693-3p	CLIP-seq
MIRT1464191	hsa-miR-4693-5p	CLIP-seq
MIRT1464192	hsa-miR-4699-3p	CLIP-seq
MIRT1464193	hsa-miR-4718	CLIP-seq
MIRT1464194	hsa-miR-4726-5p	CLIP-seq
MIRT1464195	hsa-miR-4727-5p	CLIP-seq
MIRT1464196	hsa-miR-4728-5p	CLIP-seq
MIRT1464197	hsa-miR-4739	CLIP-seq
MIRT1464198	hsa-miR-4742-5p	CLIP-seq
MIRT1464199	hsa-miR-4745-5p	CLIP-seq
MIRT1464200	hsa-miR-4747-3p	CLIP-seq
MIRT1464201	hsa-miR-4756-5p	CLIP-seq
MIRT1464202	hsa-miR-4769-3p	CLIP-seq
MIRT1464203	hsa-miR-4780	CLIP-seq
MIRT1464204	hsa-miR-4796-3p	CLIP-seq
MIRT1464205	hsa-miR-4797-5p	CLIP-seq
MIRT1464206	hsa-miR-490-5p	CLIP-seq
MIRT1464207	hsa-miR-493	CLIP-seq
MIRT1464208	hsa-miR-499a-5p	CLIP-seq
MIRT1464209	hsa-miR-512-3p	CLIP-seq
MIRT1464210	hsa-miR-519d	CLIP-seq
MIRT1464211	hsa-miR-520a-3p	CLIP-seq
MIRT1464212	hsa-miR-520b	CLIP-seq
MIRT1464213	hsa-miR-520c-3p	CLIP-seq
MIRT1464214	hsa-miR-520d-3p	CLIP-seq
MIRT1464215	hsa-miR-520d-5p	CLIP-seq
MIRT1464216	hsa-miR-520e	CLIP-seq
MIRT1464217	hsa-miR-524-5p	CLIP-seq
MIRT1464218	hsa-miR-548ah	CLIP-seq
MIRT1464219	hsa-miR-548p	CLIP-seq
MIRT1464220	hsa-miR-608	CLIP-seq
MIRT1464221	hsa-miR-618	CLIP-seq
MIRT1464222	hsa-miR-623	CLIP-seq
MIRT1464223	hsa-miR-7	CLIP-seq
MIRT1464224	hsa-miR-762	CLIP-seq
MIRT1464225	hsa-miR-890	CLIP-seq
MIRT1464226	hsa-miR-93	CLIP-seq
MIRT1464227	hsa-miR-943	CLIP-seq
MIRT1464228	hsa-miR-98	CLIP-seq
MIRT1464104	hsa-let-7a	CLIP-seq
MIRT1464105	hsa-let-7b	CLIP-seq
MIRT1464106	hsa-let-7c	CLIP-seq
MIRT1464107	hsa-let-7d	CLIP-seq
MIRT1464108	hsa-let-7e	CLIP-seq
MIRT1464109	hsa-let-7f	CLIP-seq
MIRT1464110	hsa-let-7g	CLIP-seq
MIRT1464111	hsa-let-7i	CLIP-seq
MIRT1464127	hsa-miR-203	CLIP-seq
MIRT1464147	hsa-miR-3194-3p	CLIP-seq
MIRT1464150	hsa-miR-337-5p	CLIP-seq
MIRT1464152	hsa-miR-345	CLIP-seq
MIRT1464168	hsa-miR-4458	CLIP-seq
MIRT1464169	hsa-miR-4459	CLIP-seq
MIRT1464178	hsa-miR-4500	CLIP-seq
MIRT1464185	hsa-miR-4651	CLIP-seq
MIRT1464219	hsa-miR-548p	CLIP-seq
MIRT1464220	hsa-miR-608	CLIP-seq
MIRT1464228	hsa-miR-98	CLIP-seq
MIRT1464104	hsa-let-7a	CLIP-seq
MIRT1464105	hsa-let-7b	CLIP-seq
MIRT1464106	hsa-let-7c	CLIP-seq
MIRT1464107	hsa-let-7d	CLIP-seq
MIRT1464108	hsa-let-7e	CLIP-seq
MIRT1464109	hsa-let-7f	CLIP-seq
MIRT1464110	hsa-let-7g	CLIP-seq
MIRT1464111	hsa-let-7i	CLIP-seq
MIRT1464114	hsa-miR-1183	CLIP-seq
MIRT2139616	hsa-miR-1207-5p	CLIP-seq
MIRT2139617	hsa-miR-1228	CLIP-seq
MIRT1464115	hsa-miR-1251	CLIP-seq
MIRT1464117	hsa-miR-1260	CLIP-seq
MIRT1464118	hsa-miR-1260b	CLIP-seq
MIRT2139618	hsa-miR-132	CLIP-seq
MIRT2139619	hsa-miR-140-3p	CLIP-seq
MIRT1464122	hsa-miR-154	CLIP-seq
MIRT1464124	hsa-miR-188-3p	CLIP-seq
MIRT1464127	hsa-miR-203	CLIP-seq
MIRT2139620	hsa-miR-212	CLIP-seq
MIRT1464131	hsa-miR-23a	CLIP-seq
MIRT1464132	hsa-miR-23b	CLIP-seq
MIRT1464133	hsa-miR-23c	CLIP-seq
MIRT1464134	hsa-miR-2681	CLIP-seq
MIRT1464140	hsa-miR-3115	CLIP-seq
MIRT1464144	hsa-miR-3140-5p	CLIP-seq
MIRT1464145	hsa-miR-3156-3p	CLIP-seq
MIRT1464146	hsa-miR-3179	CLIP-seq
MIRT1464147	hsa-miR-3194-3p	CLIP-seq
MIRT1464150	hsa-miR-337-5p	CLIP-seq
MIRT1464154	hsa-miR-361-3p	CLIP-seq
MIRT1464160	hsa-miR-3913-3p	CLIP-seq
MIRT1464161	hsa-miR-3936	CLIP-seq
MIRT2139621	hsa-miR-4286	CLIP-seq
MIRT1464162	hsa-miR-4313	CLIP-seq
MIRT1464163	hsa-miR-4327	CLIP-seq
MIRT2139622	hsa-miR-4443	CLIP-seq
MIRT2139623	hsa-miR-4446-5p	CLIP-seq
MIRT1464167	hsa-miR-4447	CLIP-seq
MIRT2139624	hsa-miR-4457	CLIP-seq
MIRT1464168	hsa-miR-4458	CLIP-seq
MIRT1464169	hsa-miR-4459	CLIP-seq
MIRT1464171	hsa-miR-4472	CLIP-seq
MIRT2139625	hsa-miR-4493	CLIP-seq
MIRT1464176	hsa-miR-4494	CLIP-seq
MIRT1464178	hsa-miR-4500	CLIP-seq
MIRT1464180	hsa-miR-4522	CLIP-seq
MIRT1464181	hsa-miR-4528	CLIP-seq
MIRT1464182	hsa-miR-4529-5p	CLIP-seq
MIRT1464183	hsa-miR-4640-5p	CLIP-seq
MIRT1464184	hsa-miR-4645-5p	CLIP-seq
MIRT2139626	hsa-miR-4646-3p	CLIP-seq
MIRT1464185	hsa-miR-4651	CLIP-seq
MIRT1464187	hsa-miR-4673	CLIP-seq
MIRT2139627	hsa-miR-4676-5p	CLIP-seq
MIRT1464189	hsa-miR-4690-5p	CLIP-seq
MIRT1464191	hsa-miR-4693-5p	CLIP-seq
MIRT1464192	hsa-miR-4699-3p	CLIP-seq
MIRT1464194	hsa-miR-4726-5p	CLIP-seq
MIRT1464195	hsa-miR-4727-5p	CLIP-seq
MIRT2139628	hsa-miR-4736	CLIP-seq
MIRT1464198	hsa-miR-4742-5p	CLIP-seq
MIRT1464200	hsa-miR-4747-3p	CLIP-seq
MIRT2139629	hsa-miR-4755-5p	CLIP-seq
MIRT2139630	hsa-miR-4761-5p	CLIP-seq
MIRT2139631	hsa-miR-4763-3p	CLIP-seq
MIRT1464202	hsa-miR-4769-3p	CLIP-seq
MIRT2139632	hsa-miR-4786-3p	CLIP-seq
MIRT1464205	hsa-miR-4797-5p	CLIP-seq
MIRT2139633	hsa-miR-483-3p	CLIP-seq
MIRT1464206	hsa-miR-490-5p	CLIP-seq
MIRT1464207	hsa-miR-493	CLIP-seq
MIRT1464208	hsa-miR-499a-5p	CLIP-seq
MIRT1464209	hsa-miR-512-3p	CLIP-seq
MIRT1464215	hsa-miR-520d-5p	CLIP-seq
MIRT1464217	hsa-miR-524-5p	CLIP-seq
MIRT2139634	hsa-miR-545	CLIP-seq
MIRT2139635	hsa-miR-548g	CLIP-seq
MIRT1464219	hsa-miR-548p	CLIP-seq
MIRT2139636	hsa-miR-575	CLIP-seq
MIRT2139637	hsa-miR-584	CLIP-seq
MIRT1464220	hsa-miR-608	CLIP-seq
MIRT2139638	hsa-miR-624	CLIP-seq
MIRT2139639	hsa-miR-671-5p	CLIP-seq
MIRT2139640	hsa-miR-765	CLIP-seq
MIRT1464228	hsa-miR-98	CLIP-seq
MIRT1464104	hsa-let-7a	CLIP-seq
MIRT1464105	hsa-let-7b	CLIP-seq
MIRT1464106	hsa-let-7c	CLIP-seq
MIRT1464107	hsa-let-7d	CLIP-seq
MIRT1464108	hsa-let-7e	CLIP-seq
MIRT1464109	hsa-let-7f	CLIP-seq
MIRT1464110	hsa-let-7g	CLIP-seq
MIRT1464111	hsa-let-7i	CLIP-seq
MIRT2360215	hsa-miR-101	CLIP-seq
MIRT1464112	hsa-miR-106a	CLIP-seq
MIRT1464113	hsa-miR-106b	CLIP-seq
MIRT2360216	hsa-miR-1200	CLIP-seq
MIRT2139616	hsa-miR-1207-5p	CLIP-seq
MIRT1464115	hsa-miR-1251	CLIP-seq
MIRT1464116	hsa-miR-1252	CLIP-seq
MIRT1464117	hsa-miR-1260	CLIP-seq
MIRT1464118	hsa-miR-1260b	CLIP-seq
MIRT2360217	hsa-miR-1270	CLIP-seq
MIRT1464119	hsa-miR-1273e	CLIP-seq
MIRT2139618	hsa-miR-132	CLIP-seq
MIRT2360218	hsa-miR-150	CLIP-seq
MIRT1464123	hsa-miR-17	CLIP-seq
MIRT1464124	hsa-miR-188-3p	CLIP-seq
MIRT1464126	hsa-miR-1913	CLIP-seq
MIRT2360219	hsa-miR-19a	CLIP-seq
MIRT2360220	hsa-miR-19b	CLIP-seq
MIRT1464127	hsa-miR-203	CLIP-seq
MIRT1464128	hsa-miR-20a	CLIP-seq
MIRT1464129	hsa-miR-20b	CLIP-seq
MIRT2139620	hsa-miR-212	CLIP-seq
MIRT1464134	hsa-miR-2681	CLIP-seq
MIRT1464135	hsa-miR-302a	CLIP-seq
MIRT1464136	hsa-miR-302b	CLIP-seq
MIRT1464137	hsa-miR-302c	CLIP-seq
MIRT1464138	hsa-miR-302d	CLIP-seq
MIRT1464139	hsa-miR-302e	CLIP-seq
MIRT1464143	hsa-miR-3137	CLIP-seq
MIRT1464144	hsa-miR-3140-5p	CLIP-seq
MIRT1464145	hsa-miR-3156-3p	CLIP-seq
MIRT1464146	hsa-miR-3179	CLIP-seq
MIRT1464147	hsa-miR-3194-3p	CLIP-seq
MIRT1464148	hsa-miR-3200-3p	CLIP-seq
MIRT1464149	hsa-miR-324-3p	CLIP-seq
MIRT1464150	hsa-miR-337-5p	CLIP-seq
MIRT1464152	hsa-miR-345	CLIP-seq
MIRT1464153	hsa-miR-3609	CLIP-seq
MIRT1464154	hsa-miR-361-3p	CLIP-seq
MIRT1464158	hsa-miR-372	CLIP-seq
MIRT1464159	hsa-miR-373	CLIP-seq
MIRT1464160	hsa-miR-3913-3p	CLIP-seq
MIRT2360221	hsa-miR-3914	CLIP-seq
MIRT1464161	hsa-miR-3936	CLIP-seq
MIRT1464162	hsa-miR-4313	CLIP-seq
MIRT1464163	hsa-miR-4327	CLIP-seq
MIRT2139622	hsa-miR-4443	CLIP-seq
MIRT1464168	hsa-miR-4458	CLIP-seq
MIRT1464169	hsa-miR-4459	CLIP-seq
MIRT2139625	hsa-miR-4493	CLIP-seq
MIRT1464176	hsa-miR-4494	CLIP-seq
MIRT1464178	hsa-miR-4500	CLIP-seq
MIRT1464180	hsa-miR-4522	CLIP-seq
MIRT1464181	hsa-miR-4528	CLIP-seq
MIRT1464182	hsa-miR-4529-5p	CLIP-seq
MIRT1464184	hsa-miR-4645-5p	CLIP-seq
MIRT1464185	hsa-miR-4651	CLIP-seq
MIRT1464187	hsa-miR-4673	CLIP-seq
MIRT2360222	hsa-miR-4683	CLIP-seq
MIRT1464188	hsa-miR-4688	CLIP-seq
MIRT1464189	hsa-miR-4690-5p	CLIP-seq
MIRT1464192	hsa-miR-4699-3p	CLIP-seq
MIRT1464193	hsa-miR-4718	CLIP-seq
MIRT1464195	hsa-miR-4727-5p	CLIP-seq
MIRT2139628	hsa-miR-4736	CLIP-seq
MIRT1464198	hsa-miR-4742-5p	CLIP-seq
MIRT2139631	hsa-miR-4763-3p	CLIP-seq
MIRT1464202	hsa-miR-4769-3p	CLIP-seq
MIRT2360223	hsa-miR-4774-5p	CLIP-seq
MIRT1464204	hsa-miR-4796-3p	CLIP-seq
MIRT1464206	hsa-miR-490-5p	CLIP-seq
MIRT1464208	hsa-miR-499a-5p	CLIP-seq
MIRT1464209	hsa-miR-512-3p	CLIP-seq
MIRT2360224	hsa-miR-518a-5p	CLIP-seq
MIRT1464210	hsa-miR-519d	CLIP-seq
MIRT1464211	hsa-miR-520a-3p	CLIP-seq
MIRT1464212	hsa-miR-520b	CLIP-seq
MIRT1464213	hsa-miR-520c-3p	CLIP-seq
MIRT1464214	hsa-miR-520d-3p	CLIP-seq
MIRT1464215	hsa-miR-520d-5p	CLIP-seq
MIRT1464216	hsa-miR-520e	CLIP-seq
MIRT1464217	hsa-miR-524-5p	CLIP-seq
MIRT2360225	hsa-miR-527	CLIP-seq
MIRT1464218	hsa-miR-548ah	CLIP-seq
MIRT1464219	hsa-miR-548p	CLIP-seq
MIRT1464220	hsa-miR-608	CLIP-seq
MIRT2360226	hsa-miR-620	CLIP-seq
MIRT2139640	hsa-miR-765	CLIP-seq
MIRT1464226	hsa-miR-93	CLIP-seq
MIRT1464228	hsa-miR-98	CLIP-seq
MIRT1464104	hsa-let-7a	CLIP-seq
MIRT1464105	hsa-let-7b	CLIP-seq
MIRT1464106	hsa-let-7c	CLIP-seq
MIRT1464107	hsa-let-7d	CLIP-seq
MIRT1464108	hsa-let-7e	CLIP-seq
MIRT1464109	hsa-let-7f	CLIP-seq
MIRT1464110	hsa-let-7g	CLIP-seq
MIRT1464111	hsa-let-7i	CLIP-seq
MIRT2396499	hsa-miR-1226	CLIP-seq
MIRT2396500	hsa-miR-193a-3p	CLIP-seq
MIRT2396501	hsa-miR-193b	CLIP-seq
MIRT1464127	hsa-miR-203	CLIP-seq
MIRT1464147	hsa-miR-3194-3p	CLIP-seq
MIRT1464150	hsa-miR-337-5p	CLIP-seq
MIRT1464152	hsa-miR-345	CLIP-seq
MIRT1464168	hsa-miR-4458	CLIP-seq
MIRT1464169	hsa-miR-4459	CLIP-seq
MIRT2139625	hsa-miR-4493	CLIP-seq
MIRT1464178	hsa-miR-4500	CLIP-seq
MIRT2139634	hsa-miR-545	CLIP-seq
MIRT2139635	hsa-miR-548g	CLIP-seq
MIRT1464219	hsa-miR-548p	CLIP-seq
MIRT2396502	hsa-miR-606	CLIP-seq
MIRT2396503	hsa-miR-892b	CLIP-seq
MIRT1464228	hsa-miR-98	CLIP-seq
MIRT1464104	hsa-let-7a	CLIP-seq
MIRT1464105	hsa-let-7b	CLIP-seq
MIRT1464106	hsa-let-7c	CLIP-seq
MIRT1464107	hsa-let-7d	CLIP-seq
MIRT1464108	hsa-let-7e	CLIP-seq
MIRT1464109	hsa-let-7f	CLIP-seq
MIRT1464110	hsa-let-7g	CLIP-seq
MIRT1464111	hsa-let-7i	CLIP-seq
MIRT1464114	hsa-miR-1183	CLIP-seq
MIRT1464126	hsa-miR-1913	CLIP-seq
MIRT1464127	hsa-miR-203	CLIP-seq
MIRT1464134	hsa-miR-2681	CLIP-seq
MIRT1464144	hsa-miR-3140-5p	CLIP-seq
MIRT1464146	hsa-miR-3179	CLIP-seq
MIRT1464149	hsa-miR-324-3p	CLIP-seq
MIRT1464150	hsa-miR-337-5p	CLIP-seq
MIRT1464154	hsa-miR-361-3p	CLIP-seq
MIRT1464160	hsa-miR-3913-3p	CLIP-seq
MIRT1464161	hsa-miR-3936	CLIP-seq
MIRT1464162	hsa-miR-4313	CLIP-seq
MIRT1464167	hsa-miR-4447	CLIP-seq
MIRT1464168	hsa-miR-4458	CLIP-seq
MIRT1464169	hsa-miR-4459	CLIP-seq
MIRT1464171	hsa-miR-4472	CLIP-seq
MIRT1464178	hsa-miR-4500	CLIP-seq
MIRT1464185	hsa-miR-4651	CLIP-seq
MIRT1464191	hsa-miR-4693-5p	CLIP-seq
MIRT1464192	hsa-miR-4699-3p	CLIP-seq
MIRT1464206	hsa-miR-490-5p	CLIP-seq
MIRT1464215	hsa-miR-520d-5p	CLIP-seq
MIRT1464217	hsa-miR-524-5p	CLIP-seq
MIRT1464219	hsa-miR-548p	CLIP-seq
MIRT1464220	hsa-miR-608	CLIP-seq
MIRT1464228	hsa-miR-98	CLIP-seq
MIRT1464134	hsa-miR-2681	CLIP-seq
MIRT1464160	hsa-miR-3913-3p	CLIP-seq
MIRT1464192	hsa-miR-4699-3p	CLIP-seq
MIRT1464206	hsa-miR-490-5p	CLIP-seq
MIRT1464215	hsa-miR-520d-5p	CLIP-seq
MIRT1464217	hsa-miR-524-5p	CLIP-seq
MIRT1464104	hsa-let-7a	CLIP-seq
MIRT1464105	hsa-let-7b	CLIP-seq
MIRT1464106	hsa-let-7c	CLIP-seq
MIRT1464107	hsa-let-7d	CLIP-seq
MIRT1464108	hsa-let-7e	CLIP-seq
MIRT1464109	hsa-let-7f	CLIP-seq
MIRT1464110	hsa-let-7g	CLIP-seq
MIRT1464111	hsa-let-7i	CLIP-seq
MIRT2396499	hsa-miR-1226	CLIP-seq
MIRT1464115	hsa-miR-1251	CLIP-seq
MIRT2360217	hsa-miR-1270	CLIP-seq
MIRT2139618	hsa-miR-132	CLIP-seq
MIRT2139619	hsa-miR-140-3p	CLIP-seq
MIRT2360218	hsa-miR-150	CLIP-seq
MIRT1464122	hsa-miR-154	CLIP-seq
MIRT1464126	hsa-miR-1913	CLIP-seq
MIRT2360219	hsa-miR-19a	CLIP-seq
MIRT2360220	hsa-miR-19b	CLIP-seq
MIRT1464127	hsa-miR-203	CLIP-seq
MIRT2139620	hsa-miR-212	CLIP-seq
MIRT1464131	hsa-miR-23a	CLIP-seq
MIRT1464132	hsa-miR-23b	CLIP-seq
MIRT1464133	hsa-miR-23c	CLIP-seq
MIRT1464134	hsa-miR-2681	CLIP-seq
MIRT1464140	hsa-miR-3115	CLIP-seq
MIRT2653561	hsa-miR-3127-5p	CLIP-seq
MIRT1464147	hsa-miR-3194-3p	CLIP-seq
MIRT1464149	hsa-miR-324-3p	CLIP-seq
MIRT1464150	hsa-miR-337-5p	CLIP-seq
MIRT1464152	hsa-miR-345	CLIP-seq
MIRT1464154	hsa-miR-361-3p	CLIP-seq
MIRT1464160	hsa-miR-3913-3p	CLIP-seq
MIRT1464162	hsa-miR-4313	CLIP-seq
MIRT2139622	hsa-miR-4443	CLIP-seq
MIRT2139624	hsa-miR-4457	CLIP-seq
MIRT1464168	hsa-miR-4458	CLIP-seq
MIRT1464169	hsa-miR-4459	CLIP-seq
MIRT1464178	hsa-miR-4500	CLIP-seq
MIRT1464181	hsa-miR-4528	CLIP-seq
MIRT2653562	hsa-miR-4639-3p	CLIP-seq
MIRT1464183	hsa-miR-4640-5p	CLIP-seq
MIRT1464184	hsa-miR-4645-5p	CLIP-seq
MIRT2139626	hsa-miR-4646-3p	CLIP-seq
MIRT1464185	hsa-miR-4651	CLIP-seq
MIRT1464187	hsa-miR-4673	CLIP-seq
MIRT2360222	hsa-miR-4683	CLIP-seq
MIRT1464189	hsa-miR-4690-5p	CLIP-seq
MIRT1464192	hsa-miR-4699-3p	CLIP-seq
MIRT1464194	hsa-miR-4726-5p	CLIP-seq
MIRT1464200	hsa-miR-4747-3p	CLIP-seq
MIRT2139630	hsa-miR-4761-5p	CLIP-seq
MIRT2653563	hsa-miR-4793-3p	CLIP-seq
MIRT1464205	hsa-miR-4797-5p	CLIP-seq
MIRT1464206	hsa-miR-490-5p	CLIP-seq
MIRT1464207	hsa-miR-493	CLIP-seq
MIRT2360224	hsa-miR-518a-5p	CLIP-seq
MIRT1464215	hsa-miR-520d-5p	CLIP-seq
MIRT1464217	hsa-miR-524-5p	CLIP-seq
MIRT2360225	hsa-miR-527	CLIP-seq
MIRT1464219	hsa-miR-548p	CLIP-seq
MIRT2139637	hsa-miR-584	CLIP-seq
MIRT2653564	hsa-miR-596	CLIP-seq
MIRT1464220	hsa-miR-608	CLIP-seq
MIRT2653565	hsa-miR-609	CLIP-seq
MIRT2360226	hsa-miR-620	CLIP-seq
MIRT2139638	hsa-miR-624	CLIP-seq
MIRT2653566	hsa-miR-637	CLIP-seq
MIRT2139640	hsa-miR-765	CLIP-seq
MIRT1464228	hsa-miR-98	CLIP-seq
MIRT2396499	hsa-miR-1226	CLIP-seq
MIRT2360217	hsa-miR-1270	CLIP-seq
MIRT2139618	hsa-miR-132	CLIP-seq
MIRT2139619	hsa-miR-140-3p	CLIP-seq
MIRT2360218	hsa-miR-150	CLIP-seq
MIRT2360219	hsa-miR-19a	CLIP-seq
MIRT2360220	hsa-miR-19b	CLIP-seq
MIRT2139620	hsa-miR-212	CLIP-seq
MIRT2139622	hsa-miR-4443	CLIP-seq
MIRT2139624	hsa-miR-4457	CLIP-seq
MIRT2139626	hsa-miR-4646-3p	CLIP-seq
MIRT1464185	hsa-miR-4651	CLIP-seq
MIRT2360222	hsa-miR-4683	CLIP-seq
MIRT1464192	hsa-miR-4699-3p	CLIP-seq
MIRT2139630	hsa-miR-4761-5p	CLIP-seq
MIRT2360224	hsa-miR-518a-5p	CLIP-seq
MIRT1464215	hsa-miR-520d-5p	CLIP-seq
MIRT1464217	hsa-miR-524-5p	CLIP-seq
MIRT2360225	hsa-miR-527	CLIP-seq
MIRT1464220	hsa-miR-608	CLIP-seq
MIRT2653565	hsa-miR-609	CLIP-seq
MIRT2360226	hsa-miR-620	CLIP-seq
MIRT2139638	hsa-miR-624	CLIP-seq
MIRT2139640	hsa-miR-765	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001779	Process	Natural killer cell differentiation	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 29892012, 32296183
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0006909	Process	Phagocytosis	IEA
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0032700	Process	Negative regulation of interleukin-17 production	IEA
GO:0032733	Process	Positive regulation of interleukin-10 production	IEA
GO:0048469	Process	Cell maturation	IEA
GO:0050829	Process	Defense response to Gram-negative bacterium	IEA
GO:0051881	Process	Regulation of mitochondrial membrane potential	IBA
GO:0051881	Process	Regulation of mitochondrial membrane potential	IEA
GO:0070945	Process	Neutrophil-mediated killing of gram-negative bacterium	IEA
GO:2000377	Process	Regulation of reactive oxygen species metabolic process	IEA

MIM	HGNC	e!Ensembl
607052	17034	ENSG00000114383

O75896

Protein name

Tumor suppressor candidate 2 (Fusion 1 protein) (Fus-1 protein) (PDGFA-associated protein 2)

Protein function

May function as a tumor suppressor, inhibiting colony formation, causing G1 arrest and ultimately inducing apoptosis in homozygous 3p21.3 120-kb region-deficient cells.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15000	TUSC2	1 → 109	Tumour suppressor candidate 2	Family

Tissue specificity

TISSUE SPECIFICITY: Strong expression in heart, lung, skeletal muscle, kidney, and pancreas, followed by brain and liver, lowest levels in placenta.

Sequence

MGASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLA
HEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV

Sequence length

110

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (92)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	26112163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	28351997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	23867462, 25457557, 29982879, 30050497, 31383794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	27661106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	17481701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30373693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases of the Nervous System	Autoimmune nervous system disorder	Pubtator	19852844	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11593436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31973107	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	BEFREE	11042905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15126327, 15486560, 17234782, 17486070, 17828283, 18172250, 21273575, 21645495, 24410728, 24659339, 26053020, 26081814, 28715648, 29296193, 29339375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26112163	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30944041		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25684462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	16023184, 21558960, 30374649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	25684462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	19349390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	31037993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	31325218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10901369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	40243558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutis laxa, x-linked	Cutis Laxa, X-Linked	BEFREE	28449486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10973238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	23617094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	30219035	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24434023, 26081814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35167936	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24434023, 26081814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	26081814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35167936	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	26171400, 30583904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	26171400, 30583904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28705939, 29099661, 31810742		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	7678881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29393096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	15126327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	15486560, 18172250, 24659339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21645495	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22558101, 26112163, 26367773, 27845352	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28704174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11593436, 28715648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11593436, 15126327, 15486560, 17234782, 17486070, 17828283, 18172250, 19671678, 21273575, 21645495, 24146957, 24410728, 24659339, 26053020, 26081814, 28715648, 29296193, 29339375 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30944041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28656348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10328217, 15126327, 18172250, 19852844, 23023232, 29328473, 30944041, 31785151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25684462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	19852844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	19852844	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	19852844	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	31383794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28781619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11593436, 15126327, 15486560, 17234782, 17486070, 17828283, 18172250, 19671678, 19852844, 21273575, 21645495, 23617094, 24146957, 24394498, 24410728 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29672450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	29672450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15486560, 17234782, 17486070, 17828283, 18172250, 19671678, 24146957, 26053020, 26081814, 26112163, 27845352, 29296193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonmedullary Thyroid Carcinoma	Nonmedullary thyroid carcinoma	BEFREE	24712572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	10973238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	30021578		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30944041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	30944041	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28656348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	26187439, 28656348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	27661106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28449889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	35167936	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	27707436, 29200833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Postaxial polydactyly type A	Polydactyly	BEFREE	11543628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	28351997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	31252268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	19349390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyelonephritis	Pyelonephritis	BEFREE	7729772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	21273575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	28705939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	7678881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep Apnea	BEFREE	28449889, 29066589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	27707436, 28822020, 28878129, 29200833, 30420826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep-Disordered Breathing	Sleep Apnea	BEFREE	30373693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	26112163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30219035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23403885	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	18172250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23403885		★★★★★ ★☆☆☆☆ Found in Text Mining only
STOMATOCYTOSIS I	Stomatocytosis	BEFREE	28449486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	28705939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	27661106, 31973107	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	27661106, 31973107	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	27661106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	31973107	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tricuspid Valve Insufficiency	Tricuspid Valve Insufficiency	BEFREE	28699846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31481748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	24992177		★★★★★ ★☆☆☆☆ Found in Text Mining only
X-linked recessive nephrolithiasis with renal failure	Nephrolithiasis With Renal Failure, X-Linked	BEFREE	30081763		★★★★★ ★☆☆☆☆ Found in Text Mining only

TUSC2 (tumor suppressor 2, mitochondrial calcium regulator)