ACOT7 (acyl-CoA thioesterase 7)

Gene

• Entrez ID: 11332
• Gene name: Acyl-CoA thioesterase 7
• Gene symbol: ACOT7
• Synonyms (NCBI Gene): ACH1, ACT, BACH, CTE-II, LACH, LACH1, hBACH
• Chromosome: 1
• Chromosome location: 1p36.31
• Summary: This gene encodes a member of the acyl coenzyme family. The encoded protein hydrolyzes the CoA thioester of palmitoyl-CoA and other long-chain fatty acids. Decreased expression of this gene may be associated with mesial temporal lobe epilepsy. Alternative

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020748	hsa-miR-155-5p	Proteomics	18668040
MIRT042814	hsa-miR-324-3p	CLASH	23622248
MIRT042814	hsa-miR-324-3p	CLASH	23622248
MIRT040899	hsa-miR-18a-3p	CLASH	23622248
MIRT036298	hsa-miR-1229-3p	CLASH	23622248
MIRT762957	hsa-miR-1	CLIP-seq
MIRT762958	hsa-miR-1179	CLIP-seq
MIRT762959	hsa-miR-1226	CLIP-seq
MIRT762960	hsa-miR-1243	CLIP-seq
MIRT762961	hsa-miR-1257	CLIP-seq
MIRT762962	hsa-miR-1324	CLIP-seq
MIRT762963	hsa-miR-141	CLIP-seq
MIRT762964	hsa-miR-200a	CLIP-seq
MIRT762965	hsa-miR-206	CLIP-seq
MIRT762966	hsa-miR-219-2-3p	CLIP-seq
MIRT762967	hsa-miR-2964a-3p	CLIP-seq
MIRT762968	hsa-miR-3187-3p	CLIP-seq
MIRT762969	hsa-miR-3591-3p	CLIP-seq
MIRT762970	hsa-miR-3654	CLIP-seq
MIRT762971	hsa-miR-3673	CLIP-seq
MIRT762972	hsa-miR-3940-5p	CLIP-seq
MIRT762973	hsa-miR-4267	CLIP-seq
MIRT762974	hsa-miR-4435	CLIP-seq
MIRT762975	hsa-miR-4507	CLIP-seq
MIRT762976	hsa-miR-4701-5p	CLIP-seq
MIRT762977	hsa-miR-548s	CLIP-seq
MIRT762978	hsa-miR-588	CLIP-seq
MIRT762979	hsa-miR-613	CLIP-seq
MIRT762980	hsa-miR-629	CLIP-seq
MIRT762981	hsa-miR-892a	CLIP-seq
MIRT762961	hsa-miR-1257	CLIP-seq
MIRT762982	hsa-miR-134	CLIP-seq
MIRT762966	hsa-miR-219-2-3p	CLIP-seq
MIRT762967	hsa-miR-2964a-3p	CLIP-seq
MIRT762983	hsa-miR-3118	CLIP-seq
MIRT762968	hsa-miR-3187-3p	CLIP-seq
MIRT762970	hsa-miR-3654	CLIP-seq
MIRT762984	hsa-miR-3926	CLIP-seq
MIRT762972	hsa-miR-3940-5p	CLIP-seq
MIRT762985	hsa-miR-4263	CLIP-seq
MIRT762973	hsa-miR-4267	CLIP-seq
MIRT762974	hsa-miR-4435	CLIP-seq
MIRT762986	hsa-miR-4471	CLIP-seq
MIRT762975	hsa-miR-4507	CLIP-seq
MIRT762987	hsa-miR-4638-3p	CLIP-seq
MIRT762976	hsa-miR-4701-5p	CLIP-seq
MIRT762977	hsa-miR-548s	CLIP-seq
MIRT762978	hsa-miR-588	CLIP-seq
MIRT762988	hsa-miR-625	CLIP-seq
MIRT762980	hsa-miR-629	CLIP-seq
MIRT762989	hsa-miR-296-5p	CLIP-seq
MIRT762990	hsa-miR-4659a-5p	CLIP-seq
MIRT762991	hsa-miR-4659b-5p	CLIP-seq
MIRT762992	hsa-miR-4776-3p	CLIP-seq
MIRT1924891	hsa-miR-1207-5p	CLIP-seq
MIRT762982	hsa-miR-134	CLIP-seq
MIRT762989	hsa-miR-296-5p	CLIP-seq
MIRT762983	hsa-miR-3118	CLIP-seq
MIRT762970	hsa-miR-3654	CLIP-seq
MIRT762985	hsa-miR-4263	CLIP-seq
MIRT1924892	hsa-miR-4419a	CLIP-seq
MIRT1924893	hsa-miR-4459	CLIP-seq
MIRT1924894	hsa-miR-4510	CLIP-seq
MIRT762987	hsa-miR-4638-3p	CLIP-seq
MIRT762990	hsa-miR-4659a-5p	CLIP-seq
MIRT762991	hsa-miR-4659b-5p	CLIP-seq
MIRT1924895	hsa-miR-4722-5p	CLIP-seq
MIRT1924896	hsa-miR-4736	CLIP-seq
MIRT1924897	hsa-miR-4763-3p	CLIP-seq
MIRT762992	hsa-miR-4776-3p	CLIP-seq
MIRT1924898	hsa-miR-4779	CLIP-seq
MIRT1924899	hsa-miR-765	CLIP-seq
MIRT762963	hsa-miR-141	CLIP-seq
MIRT762964	hsa-miR-200a	CLIP-seq
MIRT762990	hsa-miR-4659a-5p	CLIP-seq
MIRT762991	hsa-miR-4659b-5p	CLIP-seq
MIRT1924895	hsa-miR-4722-5p	CLIP-seq
MIRT762992	hsa-miR-4776-3p	CLIP-seq
MIRT762957	hsa-miR-1	CLIP-seq
MIRT1924891	hsa-miR-1207-5p	CLIP-seq
MIRT762960	hsa-miR-1243	CLIP-seq
MIRT2468688	hsa-miR-1286	CLIP-seq
MIRT2468689	hsa-miR-185	CLIP-seq
MIRT762965	hsa-miR-206	CLIP-seq
MIRT762989	hsa-miR-296-5p	CLIP-seq
MIRT2468690	hsa-miR-320a	CLIP-seq
MIRT2468691	hsa-miR-320b	CLIP-seq
MIRT2468692	hsa-miR-320c	CLIP-seq
MIRT2468693	hsa-miR-320d	CLIP-seq
MIRT2468694	hsa-miR-3650	CLIP-seq
MIRT762970	hsa-miR-3654	CLIP-seq
MIRT762971	hsa-miR-3673	CLIP-seq
MIRT2468695	hsa-miR-4306	CLIP-seq
MIRT2468696	hsa-miR-4429	CLIP-seq
MIRT1924893	hsa-miR-4459	CLIP-seq
MIRT2468697	hsa-miR-4464	CLIP-seq
MIRT2468698	hsa-miR-4644	CLIP-seq
MIRT762990	hsa-miR-4659a-5p	CLIP-seq
MIRT762991	hsa-miR-4659b-5p	CLIP-seq
MIRT1924895	hsa-miR-4722-5p	CLIP-seq
MIRT1924896	hsa-miR-4736	CLIP-seq
MIRT2468699	hsa-miR-4748	CLIP-seq
MIRT1924897	hsa-miR-4763-3p	CLIP-seq
MIRT2468700	hsa-miR-4768-3p	CLIP-seq
MIRT762992	hsa-miR-4776-3p	CLIP-seq
MIRT1924898	hsa-miR-4779	CLIP-seq
MIRT762979	hsa-miR-613	CLIP-seq
MIRT1924899	hsa-miR-765	CLIP-seq
MIRT2468701	hsa-miR-9	CLIP-seq
MIRT762957	hsa-miR-1	CLIP-seq
MIRT1924891	hsa-miR-1207-5p	CLIP-seq
MIRT762960	hsa-miR-1243	CLIP-seq
MIRT2468688	hsa-miR-1286	CLIP-seq
MIRT762963	hsa-miR-141	CLIP-seq
MIRT2468689	hsa-miR-185	CLIP-seq
MIRT762964	hsa-miR-200a	CLIP-seq
MIRT762965	hsa-miR-206	CLIP-seq
MIRT762989	hsa-miR-296-5p	CLIP-seq
MIRT2468690	hsa-miR-320a	CLIP-seq
MIRT2468691	hsa-miR-320b	CLIP-seq
MIRT2468692	hsa-miR-320c	CLIP-seq
MIRT2468693	hsa-miR-320d	CLIP-seq
MIRT2468694	hsa-miR-3650	CLIP-seq
MIRT762970	hsa-miR-3654	CLIP-seq
MIRT762971	hsa-miR-3673	CLIP-seq
MIRT2468695	hsa-miR-4306	CLIP-seq
MIRT2468696	hsa-miR-4429	CLIP-seq
MIRT2468697	hsa-miR-4464	CLIP-seq
MIRT2468698	hsa-miR-4644	CLIP-seq
MIRT762990	hsa-miR-4659a-5p	CLIP-seq
MIRT762991	hsa-miR-4659b-5p	CLIP-seq
MIRT1924895	hsa-miR-4722-5p	CLIP-seq
MIRT1924896	hsa-miR-4736	CLIP-seq
MIRT2468699	hsa-miR-4748	CLIP-seq
MIRT1924897	hsa-miR-4763-3p	CLIP-seq
MIRT2468700	hsa-miR-4768-3p	CLIP-seq
MIRT762992	hsa-miR-4776-3p	CLIP-seq
MIRT762979	hsa-miR-613	CLIP-seq
MIRT2468701	hsa-miR-9	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SREBF2	Activation	16335799

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000062	Function	Fatty-acyl-CoA binding	IDA	10578051
GO:0005515	Function	Protein binding	IPI	10578051, 25416956, 26949739, 32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	10578051
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006637	Process	Acyl-CoA metabolic process	IBA
GO:0009062	Process	Fatty acid catabolic process	IBA
GO:0015937	Process	Coenzyme A biosynthetic process	IDA	10578051
GO:0016787	Function	Hydrolase activity	IEA
GO:0016790	Function	Thiolester hydrolase activity	IEA
GO:0036042	Function	Long-chain fatty acyl-CoA binding	IDA	10578051
GO:0036114	Process	Medium-chain fatty-acyl-CoA catabolic process	IDA	10578051
GO:0036116	Process	Long-chain fatty-acyl-CoA catabolic process	IDA	10578051
GO:0042803	Function	Protein homodimerization activity	IPI	10578051
GO:0047617	Function	Fatty acyl-CoA hydrolase activity	IEA
GO:0051792	Process	Medium-chain fatty acid biosynthetic process	IDA	10578051
GO:0052689	Function	Carboxylic ester hydrolase activity	IEA
GO:0052816	Function	Long-chain fatty acyl-CoA hydrolase activity	IBA
GO:0052816	Function	Long-chain fatty acyl-CoA hydrolase activity	IDA	10578051
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:1900535	Process	Palmitic acid biosynthetic process	IDA	10578051

Other IDs

• MIM: 602587
• HGNC: 24157
• e!Ensembl: ENSG00000097021

Protein

• UniProt ID: O00154
• Protein name: Cytosolic acyl coenzyme A thioester hydrolase (EC 3.1.2.2) (Acyl-CoA thioesterase 7) (Brain acyl-CoA hydrolase) (BACH) (hBACH) (CTE-IIa) (CTE-II) (Long chain acyl-CoA thioester hydrolase)
• Protein function: Catalyzes the hydrolysis of acyl-CoAs into free fatty acids and coenzyme A (CoASH), regulating their respective intracellular levels (PubMed:10578051). Preferentially hydrolyzes palmitoyl-CoA, but has a broad specificity acting on other fatty ac
• PDB: 2QQ2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03061	4HBT	68 → 151	Thioesterase superfamily	Domain
  PF03061	4HBT	242 → 317	Thioesterase superfamily	Domain

• Tissue specificity: TISSUE SPECIFICITY: Isoform 4 is expressed exclusively in brain. {ECO:0000269|PubMed:12435388}.
• Sequence:

  MKLLARALRLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITGRIM
  RPDDANVAGNVHGGTILKMIEEAGAIISTRHCNSQNGERCVAALARVERTDFLSPMCIGE
  VAHVSAEITYTSKHSVEVQVNVMSENILTGAKKLTNKATLWYVPLSLKNVDKVLEVPPVV
  YSRQEQEEEGRKRYEAQKLERMETKWRNGDIVQPVLNPEPNTVSYSQSSLIHLVGPSDCT
  LHGFVHGGVTMKLMDEVAGIVAARHCKTNIVTASVDAINFHDKIRKGCVITISGRMTFTS
  NKSMEIEVLVDADPVVDSSQKRYRAASAFFTYVSLSQEGRSLPVPQLVPETEDEKKRFEE
  GKGRYLQMKAKRQGHAEPQP

• Sequence length: 380

Pathways

KEGG:

Fatty acid elongation
Biosynthesis of unsaturated fatty acids
Metabolic pathways

Reactome:

Mitochondrial Fatty Acid Beta-Oxidation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ACOT7-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	31640082		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	29125557		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	22170383		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	16570232, 7479776		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	9225693		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	16570232, 7479776		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28416579		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11793783, 2299303, 25353337, 27736038, 28636794, 28947024, 28984253, 29110960, 29223149, 29692816, 29724395, 30772471, 30831256, 31047107, 31300640, 31371165		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	31300640	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28416579		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28280732		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	28764996		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15811132, 27314662, 28518146, 29022486		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28518146	Inhibit	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	28636794		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28518146		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	40179422	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28019080		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	11289720, 1618300		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	31431060, 8244391		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	31578276		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	12050213		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	16330681, 28987235		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30608912		★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	20466371		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	16987932		★☆☆☆☆ Found in Text Mining only
Depression, Postpartum	Mental Depression	BEFREE	30498212		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	10622342, 27894822		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28416579		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28416579		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	11796176		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	9568693		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	28711113		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	31300640		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	LHGDN	15592755		★☆☆☆☆ Found in Text Mining only
Gestational trophoblastic disease	Hydatidiform mole	BEFREE	27819410		★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Neoplasms	Gestational Trophoblastic Neoplasms	BEFREE	27819410		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	29625448		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	25586468, 28844499		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25586468, 28844499		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	20209496		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	16330681		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29447737		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	17368652		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myopathy, Sporadic	Inclusion body myopathy	BEFREE	15159602		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	19959196		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	9469262		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31640082	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	31640082		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28456796		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Obstructive	Lung Diseases	BEFREE	8228125		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28518146, 37003979	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of adrenal cortex	Adrenocortical carcinoma	BEFREE	22170383		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15811132, 27314662, 29022486		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28456796		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28518146		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	20514505, 28019080		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18383875, 29125557		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25589272, 29923026, 30608912		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	8228125		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	27894822		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	29373933, 30200911		★☆☆☆☆ Found in Text Mining only
Microspherocytosis	Microspherocytosis	BEFREE	8547071		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	18078695, 30577848		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	27557625		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	28728956		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28987235		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	30589994		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25589272, 26683520, 28456796, 31285373		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	21036752		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	11936240, 27894822, 29373933		★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	BEFREE	31728184		★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	23549446		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28019080		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	10907731, 11956967, 11992569, 9219874, 9932947		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	28954297		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	28954297		★☆☆☆☆ Found in Text Mining only
PEROXISOME BIOGENESIS DISORDER, COMPLEMENTATION GROUP A	Zellweger Syndrome	BEFREE	7479776		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	16987932		★☆☆☆☆ Found in Text Mining only
Progressive pseudorheumatoid dysplasia	Progressive Pseudorheumatoid Dysplasia	BEFREE	30498212		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18383875, 29125557		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	11936240, 27894822, 29373933		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29447737		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30608912		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28776300, 30299241, 31261500		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	10474060, 24275578, 29477870		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	22139032, 23922111		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	15530656		★☆☆☆☆ Found in Text Mining only
Sleep-Disordered Breathing	Sleep Apnea	BEFREE	30489041		★☆☆☆☆ Found in Text Mining only
Spermatic Cord Torsion	Spermatic Cord Torsion	BEFREE	31444122		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	25577251		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	9831377		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32469171	Associate	★☆☆☆☆ Found in Text Mining only
Subfertility	Subfertility	BEFREE	16687568		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	29720235		★☆☆☆☆ Found in Text Mining only