Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1133
Gene name	Cholinergic receptor muscarinic 5
Gene symbol	CHRM5
Synonyms (NCBI Gene)	HM5
Chromosome	15
Chromosome location	15q14
Summary	The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, pho

Show/Hide all (33)

miRTarBase ID	miRNA	Experiments
MIRT891660	hsa-miR-3662	CLIP-seq
MIRT891661	hsa-miR-371b-5p	CLIP-seq
MIRT891662	hsa-miR-4698	CLIP-seq
MIRT891663	hsa-miR-548c-3p	CLIP-seq
MIRT891664	hsa-miR-888	CLIP-seq
MIRT1964267	hsa-miR-1178	CLIP-seq
MIRT1964268	hsa-miR-4257	CLIP-seq
MIRT1964269	hsa-miR-4793-5p	CLIP-seq
MIRT2200380	hsa-miR-520d-5p	CLIP-seq
MIRT2200381	hsa-miR-524-5p	CLIP-seq
MIRT2386054	hsa-miR-1206	CLIP-seq
MIRT2386055	hsa-miR-1208	CLIP-seq
MIRT2386056	hsa-miR-125a-5p	CLIP-seq
MIRT2386057	hsa-miR-125b	CLIP-seq
MIRT2386058	hsa-miR-4289	CLIP-seq
MIRT2386059	hsa-miR-4319	CLIP-seq
MIRT2386060	hsa-miR-4732-3p	CLIP-seq
MIRT2386061	hsa-miR-670	CLIP-seq
MIRT2447002	hsa-miR-300	CLIP-seq
MIRT2447003	hsa-miR-381	CLIP-seq
MIRT2447004	hsa-miR-4666-3p	CLIP-seq
MIRT2503222	hsa-miR-1184	CLIP-seq
MIRT2503223	hsa-miR-1301	CLIP-seq
MIRT2503224	hsa-miR-302f	CLIP-seq
MIRT2503225	hsa-miR-4660	CLIP-seq
MIRT2503226	hsa-miR-5047	CLIP-seq
MIRT2503227	hsa-miR-545	CLIP-seq
MIRT2503222	hsa-miR-1184	CLIP-seq
MIRT2503223	hsa-miR-1301	CLIP-seq
MIRT2503224	hsa-miR-302f	CLIP-seq
MIRT2503225	hsa-miR-4660	CLIP-seq
MIRT2503226	hsa-miR-5047	CLIP-seq
MIRT2503227	hsa-miR-545	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001696	Process	Gastric acid secretion	IEA
GO:0004435	Function	Phosphatidylinositol-4,5-bisphosphate phospholipase C activity	IEA
GO:0004435	Function	Phosphatidylinositol-4,5-bisphosphate phospholipase C activity	TAS	1905013
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	20398705
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	3272174
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA
GO:0007197	Process	Adenylate cyclase-inhibiting G protein-coupled acetylcholine receptor signaling pathway	IBA
GO:0007197	Process	Adenylate cyclase-inhibiting G protein-coupled acetylcholine receptor signaling pathway	TAS	8663391
GO:0007213	Process	G protein-coupled acetylcholine receptor signaling pathway	TAS	3272174
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0015872	Process	Dopamine transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016907	Function	G protein-coupled acetylcholine receptor activity	IBA
GO:0016907	Function	G protein-coupled acetylcholine receptor activity	IEA
GO:0016907	Function	G protein-coupled acetylcholine receptor activity	TAS	3272174
GO:0019226	Process	Transmission of nerve impulse	IEA
GO:0030425	Component	Dendrite	IBA
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0060304	Process	Regulation of phosphatidylinositol dephosphorylation	IEA
GO:0095500	Process	Acetylcholine receptor signaling pathway	IEA

MIM	HGNC	e!Ensembl
118496	1954	ENSG00000184984

P08912

Protein name

Muscarinic acetylcholine receptor M5

Protein function

The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effec

PDB

6OL9

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	47 → 495	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQ
LKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMN
LLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPL
DECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAE
KRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQL
TTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPN
YLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNP
NPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLG
YWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP

Sequence length

532

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway Neuroactive ligand-receptor interaction Cholinergic synapse Regulation of actin cytoskeleton Alzheimer disease Pathways of neurodegeneration - multiple diseases		Muscarinic acetylcholine receptors G alpha (q) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
INTERNET ADDICTION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Intellectual Disability	Mental retardation	BEFREE	17163532	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	17163532	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	LHGDN	17951979	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15292665	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	15292665	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	15292665	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	GWASDB_DG	23740937	★★★★★ ★☆☆☆☆ Found in Text Mining only

CHRM5 (cholinergic receptor muscarinic 5)