SLC52A3 (solute carrier family 52 member 3)

Gene

• Entrez ID: 113278
• Gene name: Solute carrier family 52 member 3
• Gene symbol: SLC52A3
• Synonyms (NCBI Gene): BVVLS, BVVLS1, C20orf54, RFT2, RFVT3, bA371L19.1, hRFT2
• Chromosome: 20
• Chromosome location: 20p13
• Summary: This gene encodes a riboflavin transporter protein that is strongly expressed in the intestine and likely plays a role in intestinal absorption of riboflavin. The protein is predicted to have eleven transmembrane domains and a cell surface localization si

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs3833341	->GTCAATCAG,GTCAG	Pathogenic, benign	Intron variant
rs267606683	C>A,T	Pathogenic	Coding sequence variant, missense variant, stop gained
rs267606685	A>G	Pathogenic	Coding sequence variant, missense variant
rs267606688	G>A,T	Pathogenic	Coding sequence variant, missense variant
rs754753126	T>C,G	Pathogenic	Splice acceptor variant
rs758570021	G>A,T	Pathogenic	Coding sequence variant, stop gained, synonymous variant
rs761224042	A>C,G	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs767263985	G>T	Pathogenic	Missense variant, coding sequence variant
rs778363575	G>A,C	Pathogenic	Coding sequence variant, synonymous variant, stop gained
rs778479139	G>A	Pathogenic	Missense variant, coding sequence variant
rs794728004	AG>-	Likely-pathogenic, pathogenic	Coding sequence variant, frameshift variant
rs797045190	A>G	Pathogenic	Missense variant, coding sequence variant
rs797045191	C>T	Pathogenic	Missense variant, coding sequence variant
rs797045192	A>T	Pathogenic	Missense variant, coding sequence variant
rs797045193	A>G	Pathogenic	Missense variant, coding sequence variant
rs797045194	G>T	Pathogenic	Missense variant, coding sequence variant
rs797045195	G>A	Pathogenic	Missense variant, coding sequence variant
rs797045196	C>A	Pathogenic	Missense variant, coding sequence variant
rs797045197	A>C	Pathogenic	Missense variant, coding sequence variant
rs797045198	C>T	Pathogenic	Missense variant, coding sequence variant
rs1057524605	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1060499531	C>G,T	Pathogenic	Stop gained, coding sequence variant, missense variant
rs1167512470	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1555783467	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1555783543	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1568721373	G>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1599959574	C>T	Likely-pathogenic	Stop gained, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT044271	hsa-miR-106b-5p	CLASH	23622248

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005634	Component	Nucleus	IDA	29428966
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	29428966
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	20463145, 22273710, 29428966
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006771	Process	Riboflavin metabolic process	IEA
GO:0006771	Process	Riboflavin metabolic process	TAS
GO:0007605	Process	Sensory perception of sound	IMP	20206331
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0031965	Component	Nuclear membrane	IEA
GO:0032217	Function	Riboflavin transmembrane transporter activity	IBA
GO:0032217	Function	Riboflavin transmembrane transporter activity	IDA	20463145
GO:0032217	Function	Riboflavin transmembrane transporter activity	IEA
GO:0032217	Function	Riboflavin transmembrane transporter activity	TAS
GO:0032218	Process	Riboflavin transport	IBA
GO:0032218	Process	Riboflavin transport	IDA	20463145, 22273710
GO:0032218	Process	Riboflavin transport	IEA
GO:0034605	Process	Cellular response to heat	IEA
GO:0072388	Process	Flavin adenine dinucleotide biosynthetic process	IEA

Other IDs

• MIM: 613350
• HGNC: 16187
• e!Ensembl: ENSG00000101276

Protein

• UniProt ID: Q9NQ40
• Protein name: Solute carrier family 52, riboflavin transporter, member 3 (Riboflavin transporter 2) (hRFT2)
• Protein function: Plasma membrane transporter mediating the uptake by cells of the water soluble vitamin B2/riboflavin that plays a key role in biochemical oxidation-reduction reactions of the carbohydrate, lipid, and amino acid metabolism (PubMed:20463145, PubMe
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06237	DUF1011	297 → 395	Protein of unknown function (DUF1011)	Family

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in testis. Highly expressed in small intestine and prostate. {ECO:0000269|PubMed:20463145}.
• Sequence:

  MAFLMHLLVCVFGMGSWVTINGLWVELPLLVMELPEGWYLPSYLTVVIQLANIGPLLVTL
  LHHFRPSCLSEVPIIFTLLGVGTVTCIIFAFLWNMTSWVLDGHHSIAFLVLTFFLALVDC
  TSSVTFLPFMSRLPTYYLTTFFVGEGLSGLLPALVALAQGSGLTTCVNVTEISDSVPSPV
  PTRETDIAQGVPRALVSALPGMEAPLSHLESRYLPAHFSPLVFFLLLSIMMACCLVAFFV
  LQRQPRCWEASVEDLLNDQVTLHSIRPREENDLGPAGTVDSSQGQGYLEEKAAPCCPAHL
  AFIYTLVAFVNALTNGMLPSVQTYSCLSYGPVAYHLAATLSIVANPLASLVSMFLPNRSL
  LFLGVLSVLGTCFGGYNMAMAVMSPCPLLQGHWGGEVLIVASWVLFSGCLSYVKVMLGVV
  LRDLSRSALLWCGAAVQLGSLLGALLMFPLVNVLRLFSSADFCNLHCPA

• Sequence length: 469

Pathways

KEGG:

Vitamin digestion and absorption

Reactome:

Vitamin B2 (riboflavin) metabolism

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Auditory neuropathy	Likely pathogenic	rs2514849190	RCV003484505	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Brown-Vialetto-van Laere syndrome 1	Pathogenic; Likely pathogenic	rs890871342, rs1986662202, rs1383679424, rs794728004, rs267606683, rs267606685, rs267606688, rs2514849071, rs761042586, rs769740240, rs754753126, rs778363575, rs797045190, rs767263985, rs1486271481, rs2514853352, rs2514848897, rs767916187, rs1555783467, rs1568721373	RCV001383229 RCV001387225 RCV001957312 RCV000000162 RCV000000163 RCV000000165 RCV000000168 RCV002289053 RCV003598113 RCV003069121 RCV000191970 RCV000191963 RCV000191956 RCV003334445 RCV003598301 RCV003599066 RCV003599067 RCV003598857 RCV000578156 RCV000761355	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Progressive bulbar palsy of childhood	Pathogenic	rs754753126, rs778363575, rs1599959574	RCV000024020 RCV002247619 RCV000985191	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BROWN-VIALETTO-VAN LAERE SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BROWN-VIALETTO-VAN LAERE SYNDROME 2	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BULBAR PALSY, PROGRESSIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Madras motor neuron disease	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Monogenic hearing loss	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSTRUCTIVE SLEEP APNEA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RFVT3-RELATED RIBOFLAVIN TRANSPORTER DEFICIENCY	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLC52A3-related disorder	Likely benign; Conflicting classifications of pathogenicity; Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	23222411		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	22766032, 30553531		★☆☆☆☆ Found in Text Mining only
Auditory neuropathy	Auditory neuropathy	Pubtator	32022482	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Blepharoptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Brown-Vialetto-Van Laere Syndrome 1	Brown-Vialetto-Van Laere Syndrome	CLINVAR_DG	20206331, 20920669, 21110228, 22633641, 22718020, 22824638		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Brown-Vialetto-Van Laere Syndrome 1	Brown-Vialetto-Van Laere Syndrome	GENOMICS_ENGLAND_DG	20206331, 20920669, 21110228		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Brown-Vialetto-Van Laere Syndrome 1	Brown-Vialetto-Van Laere Syndrome	CLINGEN_DG	20206331, 21110228, 22824638, 25462087, 26976849, 27272163, 28637675, 29053833		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Brown-Vialetto-Van Laere Syndrome 1	Brown-Vialetto-Van Laere Syndrome	UNIPROT_DG	20206331, 20920669, 21110228, 22273710, 22633641, 22718020, 22824638, 27702554		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Brown-Vialetto-Van Laere Syndrome 1	Brown-Vialetto-Van Laere Syndrome	BEFREE	22273710, 22633641, 22718020, 22740598, 22766032, 22864630, 23688382, 24079556, 26444347, 26918385, 26976849, 27702554, 29053833, 30553531, 31064337, 31500345		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Brown-Vialetto-Van Laere Syndrome 1	Brown-Vialetto-Van Laere Syndrome	CTD_human_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Brown-Vialetto-Van Laere Syndrome 1	Brown-Vialetto-Van Laere Syndrome	ORPHANET_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Bulbar palsy	Bulbar palsy	BEFREE	22864630		★☆☆☆☆ Found in Text Mining only
Bulbar palsy	Bulbar palsy	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Bulbar palsy	Bulbar palsy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Bulbar palsy	Bulbar palsy	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Bulbar Palsy Progressive	Bulbar palsy	Pubtator	20206331	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22471455, 24761851, 26722538	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24260322	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24260322	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24761851	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	31500345	Associate	★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia	Cerebellar ataxia	Pubtator	35418370	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral cortical atrophy	Cerebral cortical atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	24761851, 27584688		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	24260322		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	27584688		★☆☆☆☆ Found in Text Mining only
Childhood Progressive Bulbar Palsy	Progressive Bulbar Palsy	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Deafness	Deafness	Pubtator	20206331	Associate	★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes Insipidus	Diabetes Insipidus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	CLINVAR_DG	22740598, 22824638, 23107375, 25462087, 26976849		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	22744421, 23222411, 27600099, 29428966		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	GWASDB_DG	20729853		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	22744421, 27600099, 29428966		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	29428966, 35549728	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	22471455, 22865593, 27472962, 29428966, 35549728	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophagitis	Esotropia	Pubtator	35549728	Associate	★☆☆☆☆ Found in Text Mining only
External Ophthalmoplegia	External Ophthalmoplegia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Facial paralysis	Facial paralysis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	23222411		★☆☆☆☆ Found in Text Mining only
Fazio-Londe Syndrome	Progressive Bulbar Palsy	GENOMICS_ENGLAND_DG	20206331		★☆☆☆☆ Found in Text Mining only
Fazio-Londe Syndrome	Progressive Bulbar Palsy	BEFREE	22633641		★☆☆☆☆ Found in Text Mining only
Fazio-Londe Syndrome	Progressive Bulbar Palsy	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	22805490	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27584688		★☆☆☆☆ Found in Text Mining only
Gynecomastia	Gynecomastia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	33109881, 35418370	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	35418370	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	27272163		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	27272163		★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30156861		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26176862	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27472962, 35549728	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	22744421, 27600099, 29428966		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22791947, 28220687		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27600099, 29428966		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	27584688		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor neuron disease	Pubtator	24139842	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Acyl Coenzyme A Dehydrogenase Deficiency	Multiple Acyl-CoA Dehydrogenase Deficiency	BEFREE	30982706		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22791947, 23275236, 24260322, 27584688		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	22864630		★☆☆☆☆ Found in Text Mining only
Neurodegeneration with brain iron accumulation (NBIA)	Nephropathy with Pretibial Epidermolysis Bullosa and Deafness	BEFREE	30553531		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	26918385, 31500345	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	26973221		★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic atrophy	Pubtator	33109881	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	HPO_DG			★☆☆☆☆ Found in Text Mining only
Progressive bulbar palsy	Bulbar palsy	BEFREE	22864630		★☆☆☆☆ Found in Text Mining only
Progressive bulbar palsy	Bulbar palsy	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	GWASCAT_DG	31562322		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
RFVT3-related riboflavin transporter deficiency	Riboflavin Transporter Deficiency	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Riboflavin Deficiency	Riboflavin Deficiency	BEFREE	22231380, 27272163		★☆☆☆☆ Found in Text Mining only
Riboflavin Deficiency	Riboflavin deficiency	Pubtator	32022482, 34428344	Associate	★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	22864630		★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sensorineural hearing loss, bilateral	Sensorineural hearing loss	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep Apnea	HPO_DG			★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23222411		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	20729853, 22471455, 22533825, 23222411, 23275236, 24152165, 25045844, 25427582, 26154995, 27472962, 27584688, 29428966, 30666517		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	CTD_human_DG	20729853		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22791947, 28220687		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21427165, 22791947, 26176862, 26722538, 28220687, 32685482, 32888389	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	24761851	Associate	★☆☆☆☆ Found in Text Mining only
Vocal Cord Paralysis	Vocal Cord Paralysis	HPO_DG			★☆☆☆☆ Found in Text Mining only