ACKR5 (atypical chemokine receptor 5)

Gene

• Entrez ID: 11318
• Gene name: Atypical chemokine receptor 5
• Gene symbol: ACKR5
• Synonyms (NCBI Gene): 7TMR, ADMR, AM-R, AMR, G10D, GPR182, L1-R, gamrh, hrhAMR
• Chromosome: 12
• Chromosome location: 12q13.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT530813	hsa-miR-4762-5p	PAR-CLIP	22012620
MIRT530811	hsa-miR-1224-3p	PAR-CLIP	22012620
MIRT530812	hsa-miR-6511a-3p	PAR-CLIP	22012620
MIRT530810	hsa-miR-6511b-3p	PAR-CLIP	22012620
MIRT530809	hsa-miR-6784-3p	PAR-CLIP	22012620
MIRT530808	hsa-miR-6862-3p	PAR-CLIP	22012620
MIRT530807	hsa-miR-150-5p	PAR-CLIP	22012620
MIRT530806	hsa-miR-532-3p	PAR-CLIP	22012620
MIRT530805	hsa-miR-2116-3p	PAR-CLIP	22012620
MIRT530804	hsa-miR-1260a	PAR-CLIP	22012620
MIRT530803	hsa-miR-1260b	PAR-CLIP	22012620
MIRT530802	hsa-miR-1229-3p	PAR-CLIP	22012620
MIRT530801	hsa-miR-4713-5p	PAR-CLIP	22012620
MIRT530813	hsa-miR-4762-5p	PAR-CLIP	22012620
MIRT530811	hsa-miR-1224-3p	PAR-CLIP	22012620
MIRT530812	hsa-miR-6511a-3p	PAR-CLIP	22012620
MIRT530810	hsa-miR-6511b-3p	PAR-CLIP	22012620
MIRT530809	hsa-miR-6784-3p	PAR-CLIP	22012620
MIRT530808	hsa-miR-6862-3p	PAR-CLIP	22012620
MIRT530807	hsa-miR-150-5p	PAR-CLIP	22012620
MIRT530806	hsa-miR-532-3p	PAR-CLIP	22012620
MIRT530805	hsa-miR-2116-3p	PAR-CLIP	22012620
MIRT530804	hsa-miR-1260a	PAR-CLIP	22012620
MIRT530803	hsa-miR-1260b	PAR-CLIP	22012620
MIRT530802	hsa-miR-1229-3p	PAR-CLIP	22012620
MIRT530801	hsa-miR-4713-5p	PAR-CLIP	22012620
MIRT2238464	hsa-miR-1208	CLIP-seq
MIRT2238465	hsa-miR-205	CLIP-seq
MIRT2238466	hsa-miR-3176	CLIP-seq
MIRT2238467	hsa-miR-3922-3p	CLIP-seq
MIRT2238468	hsa-miR-4294	CLIP-seq
MIRT2238469	hsa-miR-4420	CLIP-seq
MIRT2238470	hsa-miR-4443	CLIP-seq
MIRT2238471	hsa-miR-4757-5p	CLIP-seq
MIRT2238472	hsa-miR-765	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	9367907
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	9367907
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9367907

Other IDs

• MIM: 605307
• HGNC: 13708
• e!Ensembl: ENSG00000166856

Protein

• UniProt ID: O15218
• Protein name: G-protein coupled receptor 182
• Protein function: Orphan receptor.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	70 → 320	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in heart, skeletal muscle, immune system, adrenal gland and liver. {ECO:0000269|PubMed:9367907}.
• Sequence:

  MSVKPSWGPGPSEGVTAVPTSDLGEIHNWTELLDLFNHTLSECHVELSQSTKRVVLFALY
  LAMFVVGLVENLLVICVNWRGSGRAGLMNLYILNMAIADLGIVLSLPVWMLEVTLDYTWL
  WGSFSCRFTHYFYFVNMYSSIFFLVCLSVDRYVTLTSASPSWQRYQHRVRRAMCAGIWVL
  SAIIPLPEVVHIQLVEGPEPMCLFMAPFETYSTWALAVALSTTILGFLLPFPLITVFNVL
  TACRLRQPGQPKSRRHCLLLCAYVAVFVMCWLPYHVTLLLLTLHGTHISLHCHLVHLLYF
  FYDVIDCFSMLHCVINPILYNFLSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCSTQHS
  IIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS

• Sequence length: 404

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	28094771		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	28094771		★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	LHGDN	11712085		★☆☆☆☆ Found in Text Mining only
Atypical Hemolytic Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	25538218		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17028990		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	28094771		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29408502	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32231177	Associate	★☆☆☆☆ Found in Text Mining only
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	31523552		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	12877796		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	14720432		★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	29222866		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27556517		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31036871, 31205027		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	31679637		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29408502		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	29408502	Inhibit	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	17363587		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17363587, 30300145		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	17363587		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27556517		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	10777702		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	27916323, 29222866		★☆☆☆☆ Found in Text Mining only