Gene Gene information from NCBI Gene database.
Entrez ID 113179
Gene name Adenosine deaminase tRNA specific 3
Gene symbol ADAT3
Synonyms (NCBI Gene)
FWP005MRT36MST121MSTP121NEDBGFS863-5TAD3
Chromosome 19
Chromosome location 19p13.3
Summary This gene encodes a subunit of a tRNA-specific adenosine deaminase. This heterodimeric enzyme converts adenosine to inosine in the tRNA anticodon. A mutation in this gene causes a syndrome characterized by intellectual disability and strabismus. This gene
miRNA miRNA information provided by mirtarbase database.
11
miRTarBase ID miRNA Experiments Reference
MIRT767663 hsa-miR-147b CLIP-seq
MIRT767664 hsa-miR-210 CLIP-seq
MIRT767665 hsa-miR-3155 CLIP-seq
MIRT767666 hsa-miR-3155b CLIP-seq
MIRT767667 hsa-miR-484 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7
GO ID Ontology Definition Evidence Reference
GO:0003824 Function Catalytic activity IEA
GO:0005515 Function Protein binding IPI 32296183, 33961781
GO:0005634 Component Nucleus IBA
GO:0005654 Component Nucleoplasm TAS
GO:0005737 Component Cytoplasm IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
615302 25151 ENSG00000213638
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96EY9
Protein name Probable inactive tRNA-specific adenosine deaminase-like protein 3 (tRNA-specific adenosine-34 deaminase subunit ADAT3)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00383 dCMP_cyt_deam_1 170 310 Cytidine and deoxycytidylate deaminase zinc-binding region Family
Sequence
MEPAPGLVEQPKCLEAGSPEPEPAPWQALPVLSEKQSGDVELVLAYAAPVLDKRQTSRLL
KEVSALHPLPAQPHLKRVRPSRDAGSPHALEMLLCLAGPASGPRSLAELLPRPAVDPRGL
GQPFLVPVPARPPLTRGQFEEARAHWPTSFHEDKQVTSALAGRLFSTQERAAMQSHMERA
VWAARRAAARGLRAVGAVVVDPASDRVLATGHDCSCADNPLLHAVMVCVDLVARGQGRGT
YDFRPFPACSFAPAAAPQAVRAGAVRKLDADEDGLPYLCTGYDLYVTREPCAMCAMALVH
ARILRVFYGA
PSPDGALGTRFRIHARPDLNHRFQVFRGVLEEQCRWLDPDT
Sequence length 351
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    tRNA modification in the nucleus and cytosol
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
7
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Intellectual disability-strabismus syndrome Likely pathogenic; Pathogenic rs752360082, rs746859902 RCV005023263
RCV000664409
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ADAT3-related disorder Benign; Likely benign; Uncertain significance; Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Intellectual disability Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DISABILITY WITH STRABISMUS SYNDROME Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Microcephaly Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Agenesis of corpus callosum Agenesis Of Corpus Callosum HPO_DG
★☆☆☆☆
Found in Text Mining only
Brain atrophy Brain atrophy HPO_DG
★☆☆☆☆
Found in Text Mining only
Cerebral atrophy Cerebral Atrophy HPO_DG
★☆☆☆☆
Found in Text Mining only
Cerebral Palsy Cerebral palsy Pubtator 35076175 Associate
★☆☆☆☆
Found in Text Mining only
Congenital Epicanthus Congenital Epicanthus HPO_DG
★☆☆☆☆
Found in Text Mining only
Dwarfism Dwarfism HPO_DG
★☆☆☆☆
Found in Text Mining only
Esotropia Esotropia HPO_DG
★☆☆☆☆
Found in Text Mining only
Impaired cognition Impaired Cognition BEFREE 26842963
★☆☆☆☆
Found in Text Mining only
Intellectual Disability Mental retardation BEFREE 26842963, 30296593, 31263000
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Intellectual Disability Intellectual developmental disorder Pubtator 31263000, 32763916, 35405382 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations