IZUMO4 (IZUMO family member 4)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 113177
Gene name IZUMO family member 4
Gene symbol IZUMO4
Synonyms (NCBI Gene)
C19orf36IMAGE:4215339
Chromosome 19
Chromosome location 19p13.3
miRNA miRNA information provided by mirtarbase database.
2
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT2018830 hsa-miR-1291 CLIP-seq
MIRT2018831 hsa-miR-328 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0005634 Component Nucleus HDA 21630459
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
618897 26950 ENSG00000099840
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q1ZYL8
Protein name Izumo sperm-egg fusion protein 4 (Sperm 22 kDa protein c113)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15005 IZUMO 17 → 157 Izumo sperm-egg fusion, Ig domain-associated Family
Tissue specificity TISSUE SPECIFICITY: Detected in sperm. {ECO:0000269|Ref.1}.
Sequence 
MALLLCLVCLTAALAHGCLHCHSNFSKKFSFYRHHVNFKSWWVGDIPVSGALLTDWSDDT
MKELHLAIPAKITREKLDQVATAVYQMMDQLYQGKMYFPGYFPNELRNIFREQVHLIQNA
IIESRIDCQHRCGIFQYETISCNNCTDSHVACFGYNCESSAQWKSAVQGLLNYINNWHKQ
DTSMRPRSSAFSWPGTHRATPAFLVSPALRCLEPPHLANLTLEDAAECLKQH
Sequence length 232
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Acrosome Reaction and Sperm:Oocyte Membrane Binding

No strongly related genes found yet for IZUMO4.

No additional diseases found yet through genes similar to IZUMO4.