Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	113130
Gene name	Cell division cycle associated 5
Gene symbol	CDCA5
Synonyms (NCBI Gene)	SORORIN
Chromosome	11
Chromosome location	11q13.1

221

Show/Hide all (221)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016488	hsa-miR-193b-3p	Microarray	20304954
MIRT050732	hsa-miR-18a-5p	CLASH	23622248
MIRT042416	hsa-miR-18b-5p	CLASH	23622248
MIRT878939	hsa-miR-1197	CLIP-seq
MIRT878940	hsa-miR-1224-5p	CLIP-seq
MIRT878941	hsa-miR-1231	CLIP-seq
MIRT878942	hsa-miR-1236	CLIP-seq
MIRT878943	hsa-miR-1296	CLIP-seq
MIRT878944	hsa-miR-1321	CLIP-seq
MIRT878945	hsa-miR-148a	CLIP-seq
MIRT878946	hsa-miR-148b	CLIP-seq
MIRT878947	hsa-miR-152	CLIP-seq
MIRT878948	hsa-miR-1909	CLIP-seq
MIRT878949	hsa-miR-2110	CLIP-seq
MIRT878950	hsa-miR-214	CLIP-seq
MIRT878951	hsa-miR-2355-5p	CLIP-seq
MIRT878952	hsa-miR-302f	CLIP-seq
MIRT878953	hsa-miR-3120-5p	CLIP-seq
MIRT878954	hsa-miR-3144-5p	CLIP-seq
MIRT878955	hsa-miR-3150a-3p	CLIP-seq
MIRT878956	hsa-miR-3175	CLIP-seq
MIRT878957	hsa-miR-3183	CLIP-seq
MIRT878958	hsa-miR-3192	CLIP-seq
MIRT878959	hsa-miR-3199	CLIP-seq
MIRT878960	hsa-miR-326	CLIP-seq
MIRT878961	hsa-miR-330-5p	CLIP-seq
MIRT878962	hsa-miR-3619-5p	CLIP-seq
MIRT878963	hsa-miR-3689d	CLIP-seq
MIRT878964	hsa-miR-3909	CLIP-seq
MIRT878965	hsa-miR-3943	CLIP-seq
MIRT878966	hsa-miR-411	CLIP-seq
MIRT878967	hsa-miR-4260	CLIP-seq
MIRT878968	hsa-miR-4270	CLIP-seq
MIRT878969	hsa-miR-4276	CLIP-seq
MIRT878970	hsa-miR-4282	CLIP-seq
MIRT878971	hsa-miR-4314	CLIP-seq
MIRT878972	hsa-miR-4436a	CLIP-seq
MIRT878973	hsa-miR-4441	CLIP-seq
MIRT878974	hsa-miR-4459	CLIP-seq
MIRT878975	hsa-miR-4468	CLIP-seq
MIRT878976	hsa-miR-4476	CLIP-seq
MIRT878977	hsa-miR-4480	CLIP-seq
MIRT878978	hsa-miR-4490	CLIP-seq
MIRT878979	hsa-miR-4496	CLIP-seq
MIRT878980	hsa-miR-4512	CLIP-seq
MIRT878981	hsa-miR-4530	CLIP-seq
MIRT878982	hsa-miR-4533	CLIP-seq
MIRT878983	hsa-miR-4646-5p	CLIP-seq
MIRT878984	hsa-miR-4690-3p	CLIP-seq
MIRT878985	hsa-miR-4699-3p	CLIP-seq
MIRT878986	hsa-miR-4700-3p	CLIP-seq
MIRT878987	hsa-miR-4723-3p	CLIP-seq
MIRT878988	hsa-miR-4728-5p	CLIP-seq
MIRT878989	hsa-miR-4739	CLIP-seq
MIRT878990	hsa-miR-4751	CLIP-seq
MIRT878991	hsa-miR-4753-3p	CLIP-seq
MIRT878992	hsa-miR-4756-5p	CLIP-seq
MIRT878993	hsa-miR-4768-5p	CLIP-seq
MIRT878994	hsa-miR-4774-5p	CLIP-seq
MIRT878995	hsa-miR-548ae	CLIP-seq
MIRT878996	hsa-miR-548aj	CLIP-seq
MIRT878997	hsa-miR-548am	CLIP-seq
MIRT878998	hsa-miR-548x	CLIP-seq
MIRT878999	hsa-miR-595	CLIP-seq
MIRT879000	hsa-miR-626	CLIP-seq
MIRT879001	hsa-miR-645	CLIP-seq
MIRT879002	hsa-miR-661	CLIP-seq
MIRT879003	hsa-miR-761	CLIP-seq
MIRT879004	hsa-miR-939	CLIP-seq
MIRT878939	hsa-miR-1197	CLIP-seq
MIRT1960551	hsa-miR-1226	CLIP-seq
MIRT878941	hsa-miR-1231	CLIP-seq
MIRT1960552	hsa-miR-1256	CLIP-seq
MIRT1960553	hsa-miR-1273f	CLIP-seq
MIRT878944	hsa-miR-1321	CLIP-seq
MIRT1960554	hsa-miR-143	CLIP-seq
MIRT878945	hsa-miR-148a	CLIP-seq
MIRT878946	hsa-miR-148b	CLIP-seq
MIRT878947	hsa-miR-152	CLIP-seq
MIRT878948	hsa-miR-1909	CLIP-seq
MIRT1960555	hsa-miR-198	CLIP-seq
MIRT1960556	hsa-miR-203	CLIP-seq
MIRT878950	hsa-miR-214	CLIP-seq
MIRT878951	hsa-miR-2355-5p	CLIP-seq
MIRT1960557	hsa-miR-2467-3p	CLIP-seq
MIRT1960558	hsa-miR-2964a-3p	CLIP-seq
MIRT1960559	hsa-miR-29a	CLIP-seq
MIRT1960560	hsa-miR-29b	CLIP-seq
MIRT1960561	hsa-miR-29c	CLIP-seq
MIRT1960562	hsa-miR-3065-3p	CLIP-seq
MIRT878953	hsa-miR-3120-5p	CLIP-seq
MIRT878954	hsa-miR-3144-5p	CLIP-seq
MIRT1960563	hsa-miR-3155	CLIP-seq
MIRT1960564	hsa-miR-3155b	CLIP-seq
MIRT1960565	hsa-miR-3157-3p	CLIP-seq
MIRT878958	hsa-miR-3192	CLIP-seq
MIRT878959	hsa-miR-3199	CLIP-seq
MIRT878960	hsa-miR-326	CLIP-seq
MIRT878961	hsa-miR-330-5p	CLIP-seq
MIRT878962	hsa-miR-3619-5p	CLIP-seq
MIRT1960566	hsa-miR-3661	CLIP-seq
MIRT1960567	hsa-miR-3925-3p	CLIP-seq
MIRT878965	hsa-miR-3943	CLIP-seq
MIRT1960568	hsa-miR-4267	CLIP-seq
MIRT878969	hsa-miR-4276	CLIP-seq
MIRT1960569	hsa-miR-4290	CLIP-seq
MIRT878971	hsa-miR-4314	CLIP-seq
MIRT878975	hsa-miR-4468	CLIP-seq
MIRT1960570	hsa-miR-4505	CLIP-seq
MIRT878981	hsa-miR-4530	CLIP-seq
MIRT1960571	hsa-miR-4640-5p	CLIP-seq
MIRT878983	hsa-miR-4646-5p	CLIP-seq
MIRT878984	hsa-miR-4690-3p	CLIP-seq
MIRT1960572	hsa-miR-4691-5p	CLIP-seq
MIRT878985	hsa-miR-4699-3p	CLIP-seq
MIRT1960573	hsa-miR-4708-5p	CLIP-seq
MIRT1960574	hsa-miR-4720-5p	CLIP-seq
MIRT1960575	hsa-miR-4726-5p	CLIP-seq
MIRT878988	hsa-miR-4728-5p	CLIP-seq
MIRT878989	hsa-miR-4739	CLIP-seq
MIRT1960576	hsa-miR-4755-3p	CLIP-seq
MIRT1960577	hsa-miR-4756-3p	CLIP-seq
MIRT878992	hsa-miR-4756-5p	CLIP-seq
MIRT878993	hsa-miR-4768-5p	CLIP-seq
MIRT1960578	hsa-miR-4770	CLIP-seq
MIRT1960579	hsa-miR-4778-3p	CLIP-seq
MIRT1960580	hsa-miR-4799-3p	CLIP-seq
MIRT1960581	hsa-miR-484	CLIP-seq
MIRT1960582	hsa-miR-515-5p	CLIP-seq
MIRT1960583	hsa-miR-520a-5p	CLIP-seq
MIRT1960584	hsa-miR-525-5p	CLIP-seq
MIRT878999	hsa-miR-595	CLIP-seq
MIRT1960585	hsa-miR-618	CLIP-seq
MIRT879000	hsa-miR-626	CLIP-seq
MIRT1960586	hsa-miR-631	CLIP-seq
MIRT1960587	hsa-miR-634	CLIP-seq
MIRT879001	hsa-miR-645	CLIP-seq
MIRT879003	hsa-miR-761	CLIP-seq
MIRT1960588	hsa-miR-766	CLIP-seq
MIRT1960589	hsa-miR-874	CLIP-seq
MIRT2197254	hsa-miR-10a	CLIP-seq
MIRT2197255	hsa-miR-10b	CLIP-seq
MIRT878939	hsa-miR-1197	CLIP-seq
MIRT878940	hsa-miR-1224-5p	CLIP-seq
MIRT1960551	hsa-miR-1226	CLIP-seq
MIRT1960552	hsa-miR-1256	CLIP-seq
MIRT878943	hsa-miR-1296	CLIP-seq
MIRT878945	hsa-miR-148a	CLIP-seq
MIRT878946	hsa-miR-148b	CLIP-seq
MIRT878947	hsa-miR-152	CLIP-seq
MIRT2197256	hsa-miR-1910	CLIP-seq
MIRT878949	hsa-miR-2110	CLIP-seq
MIRT878950	hsa-miR-214	CLIP-seq
MIRT878951	hsa-miR-2355-5p	CLIP-seq
MIRT2197257	hsa-miR-2909	CLIP-seq
MIRT1960559	hsa-miR-29a	CLIP-seq
MIRT1960560	hsa-miR-29b	CLIP-seq
MIRT1960561	hsa-miR-29c	CLIP-seq
MIRT1960562	hsa-miR-3065-3p	CLIP-seq
MIRT2197258	hsa-miR-3119	CLIP-seq
MIRT2197259	hsa-miR-3130-3p	CLIP-seq
MIRT878954	hsa-miR-3144-5p	CLIP-seq
MIRT878955	hsa-miR-3150a-3p	CLIP-seq
MIRT1960563	hsa-miR-3155	CLIP-seq
MIRT1960564	hsa-miR-3155b	CLIP-seq
MIRT2197260	hsa-miR-3157-5p	CLIP-seq
MIRT878956	hsa-miR-3175	CLIP-seq
MIRT2197261	hsa-miR-3176	CLIP-seq
MIRT878962	hsa-miR-3619-5p	CLIP-seq
MIRT2197262	hsa-miR-3691-3p	CLIP-seq
MIRT2197263	hsa-miR-3922-3p	CLIP-seq
MIRT2197264	hsa-miR-421	CLIP-seq
MIRT878967	hsa-miR-4260	CLIP-seq
MIRT878969	hsa-miR-4276	CLIP-seq
MIRT2197265	hsa-miR-4419a	CLIP-seq
MIRT2197266	hsa-miR-4435	CLIP-seq
MIRT878972	hsa-miR-4436a	CLIP-seq
MIRT878974	hsa-miR-4459	CLIP-seq
MIRT2197267	hsa-miR-4510	CLIP-seq
MIRT878980	hsa-miR-4512	CLIP-seq
MIRT878981	hsa-miR-4530	CLIP-seq
MIRT2197268	hsa-miR-4676-5p	CLIP-seq
MIRT2197269	hsa-miR-4691-3p	CLIP-seq
MIRT878986	hsa-miR-4700-3p	CLIP-seq
MIRT2197270	hsa-miR-4707-3p	CLIP-seq
MIRT2197271	hsa-miR-4709-5p	CLIP-seq
MIRT2197272	hsa-miR-4711-5p	CLIP-seq
MIRT2197273	hsa-miR-4714-3p	CLIP-seq
MIRT1960574	hsa-miR-4720-5p	CLIP-seq
MIRT878988	hsa-miR-4728-5p	CLIP-seq
MIRT2197274	hsa-miR-4732-3p	CLIP-seq
MIRT2197275	hsa-miR-4738-5p	CLIP-seq
MIRT878990	hsa-miR-4751	CLIP-seq
MIRT2197276	hsa-miR-4779	CLIP-seq
MIRT1960580	hsa-miR-4799-3p	CLIP-seq
MIRT1960581	hsa-miR-484	CLIP-seq
MIRT2197277	hsa-miR-490-3p	CLIP-seq
MIRT2197278	hsa-miR-575	CLIP-seq
MIRT878999	hsa-miR-595	CLIP-seq
MIRT1960585	hsa-miR-618	CLIP-seq
MIRT1960587	hsa-miR-634	CLIP-seq
MIRT879001	hsa-miR-645	CLIP-seq
MIRT879003	hsa-miR-761	CLIP-seq
MIRT2197279	hsa-miR-922	CLIP-seq
MIRT879004	hsa-miR-939	CLIP-seq
MIRT1960562	hsa-miR-3065-3p	CLIP-seq
MIRT2197259	hsa-miR-3130-3p	CLIP-seq
MIRT2197261	hsa-miR-3176	CLIP-seq
MIRT2197263	hsa-miR-3922-3p	CLIP-seq
MIRT2197269	hsa-miR-4691-3p	CLIP-seq
MIRT2197270	hsa-miR-4707-3p	CLIP-seq
MIRT2446660	hsa-miR-103a	CLIP-seq
MIRT2446661	hsa-miR-107	CLIP-seq
MIRT2446662	hsa-miR-1184	CLIP-seq
MIRT2446663	hsa-miR-759	CLIP-seq
MIRT2197279	hsa-miR-922	CLIP-seq
MIRT2446660	hsa-miR-103a	CLIP-seq
MIRT2446661	hsa-miR-107	CLIP-seq
MIRT2446662	hsa-miR-1184	CLIP-seq
MIRT2446663	hsa-miR-759	CLIP-seq
MIRT2197279	hsa-miR-922	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000775	Component	Chromosome, centromeric region	TAS
GO:0000785	Component	Chromatin	IEA
GO:0000785	Component	Chromatin	ISS
GO:0003682	Function	Chromatin binding	TAS	15837422
GO:0005515	Function	Protein binding	IPI	21111234, 22885700, 23242214, 26496610, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005694	Component	Chromosome	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006302	Process	Double-strand break repair	IBA
GO:0006302	Process	Double-strand break repair	IMP	17349791
GO:0007064	Process	Mitotic sister chromatid cohesion	IBA
GO:0007064	Process	Mitotic sister chromatid cohesion	IEA
GO:0007064	Process	Mitotic sister chromatid cohesion	IMP	15837422, 17349791, 21111234
GO:0007064	Process	Mitotic sister chromatid cohesion	IPI	21111234
GO:0044877	Function	Protein-containing complex binding	IDA	15837422
GO:0051301	Process	Cell division	IEA

MIM	HGNC	e!Ensembl
609374	14626	ENSG00000146670

Q96FF9

Protein name

Sororin (Cell division cycle-associated protein 5) (p35)

Protein function

Regulator of sister chromatid cohesion in mitosis stabilizing cohesin complex association with chromatin. May antagonize the action of WAPL which stimulates cohesin dissociation from chromatin. Cohesion ensures that chromosome partitioning is ac

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09666	Sororin	89 → 215	Sororin protein	Family

Sequence

MSGRRTRSGGAAQRSGPRAPSPTKPLRRSQRKSGSELPSILPEIWPKTPSAAAVRKPIVL
KRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNP
EAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGV
SPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEILKTELDEWAAAMNAE
FEAAEQFDLLVE

Sequence length

252

Interactions

View interactions

	KEGG		Reactome
	Cell cycle MicroRNAs in cancer		Separation of Sister Chromatids Establishment of Sister Chromatid Cohesion Resolution of Sister Chromatid Cohesion

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (83)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	15917097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	28912154		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	21825040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11228158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	35003319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	26164757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	18205865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29467944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31280346	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31758680, 35506437, 36004470	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36233194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31811111, 32694239, 33830865, 34737790, 39874008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	20551060, 22696682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	34143800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	20603238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	17493033, 30158515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	21544067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30808873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33190424	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	11118734, 9502407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10593565, 12496451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	28912154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	18075258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ganglioglioma	Ganglioglioma	BEFREE	15175076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	29731755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	18588867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33449451	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	31715265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	24994465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	8656012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	21544067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	26164757, 26469698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29503564, 30015982, 30497429, 30719129, 31205541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35373420	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10525320, 11014347, 12472178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	34509929	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	12153001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	12153001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	12153001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29467944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30497429, 31205541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20551060, 22696682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	20603238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21825040, 31472403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29326043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20181942, 20551060, 20603238, 26497678, 29326043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	17145757		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29452217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	26469698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	27840913	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	15009685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11358987, 12460909, 16763609, 16823838, 20603238, 28640256, 29503564, 30497429, 31324603		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	21338355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15485494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	15307952, 17979810, 21844361, 24725413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	16525053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31190860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	20181942		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	20603238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34077004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21825040, 31472403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	21825040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33437202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paratuberculosis	Paratuberculosis	BEFREE	11118734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	18588867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	26164757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15123618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34509929, 35119046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	29802736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	31317786, 31788758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	25697137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	21772061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	25878277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31324603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32716971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29326043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32759885	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	29535807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	22612807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35993042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
X-Linked Lissencephaly	Lissencephaly, X-Linked	BEFREE	10826984		★★★★★ ★☆☆☆☆ Found in Text Mining only

CDCA5 (cell division cycle associated 5)