CHRM3 (cholinergic receptor muscarinic 3)

Gene

• Entrez ID: 1131
• Gene name: Cholinergic receptor muscarinic 3
• Gene symbol: CHRM3
• Synonyms (NCBI Gene): EGBRS, HM3, PBS, m3AChR
• Chromosome: 1
• Chromosome location: 1q43
• Summary: The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, pho

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs587776862	GCCTGAGGAGGA>T	Pathogenic	Genic downstream transcript variant, coding sequence variant, frameshift variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018504	hsa-miR-335-5p	Microarray	18185580
MIRT038434	hsa-miR-296-3p	CLASH	23622248
MIRT524478	hsa-miR-4789-3p	HITS-CLIP	21572407
MIRT524477	hsa-miR-4643	HITS-CLIP	21572407
MIRT524476	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT524475	hsa-miR-466	HITS-CLIP	21572407
MIRT524474	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT524473	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT524472	hsa-miR-5590-5p	HITS-CLIP	21572407
MIRT524471	hsa-miR-4659a-5p	HITS-CLIP	21572407
MIRT524470	hsa-miR-4659b-5p	HITS-CLIP	21572407
MIRT524469	hsa-miR-4776-3p	HITS-CLIP	21572407
MIRT524468	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT612111	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT612110	hsa-miR-508-3p	HITS-CLIP	23824327
MIRT612109	hsa-miR-219a-5p	HITS-CLIP	23824327
MIRT612108	hsa-miR-4782-3p	HITS-CLIP	23824327
MIRT612107	hsa-miR-6766-3p	HITS-CLIP	23824327
MIRT612106	hsa-miR-4445-5p	HITS-CLIP	23824327
MIRT612105	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612104	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612103	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612102	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612111	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT612110	hsa-miR-508-3p	HITS-CLIP	23824327
MIRT612109	hsa-miR-219a-5p	HITS-CLIP	23824327
MIRT612108	hsa-miR-4782-3p	HITS-CLIP	23824327
MIRT612107	hsa-miR-6766-3p	HITS-CLIP	23824327
MIRT612106	hsa-miR-4445-5p	HITS-CLIP	23824327
MIRT612105	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612104	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612103	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612102	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612111	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT612110	hsa-miR-508-3p	HITS-CLIP	23824327
MIRT612109	hsa-miR-219a-5p	HITS-CLIP	23824327
MIRT612108	hsa-miR-4782-3p	HITS-CLIP	23824327
MIRT612107	hsa-miR-6766-3p	HITS-CLIP	23824327
MIRT612106	hsa-miR-4445-5p	HITS-CLIP	23824327
MIRT612105	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612104	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612103	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612102	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612111	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT612110	hsa-miR-508-3p	HITS-CLIP	23824327
MIRT612109	hsa-miR-219a-5p	HITS-CLIP	23824327
MIRT612108	hsa-miR-4782-3p	HITS-CLIP	23824327
MIRT612107	hsa-miR-6766-3p	HITS-CLIP	23824327
MIRT612106	hsa-miR-4445-5p	HITS-CLIP	23824327
MIRT612105	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612104	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612103	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612102	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612111	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT612110	hsa-miR-508-3p	HITS-CLIP	23824327
MIRT612109	hsa-miR-219a-5p	HITS-CLIP	23824327
MIRT612108	hsa-miR-4782-3p	HITS-CLIP	23824327
MIRT612107	hsa-miR-6766-3p	HITS-CLIP	23824327
MIRT612106	hsa-miR-4445-5p	HITS-CLIP	23824327
MIRT612105	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612104	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612103	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612102	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612111	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT612110	hsa-miR-508-3p	HITS-CLIP	23824327
MIRT612109	hsa-miR-219a-5p	HITS-CLIP	23824327
MIRT612108	hsa-miR-4782-3p	HITS-CLIP	23824327
MIRT612107	hsa-miR-6766-3p	HITS-CLIP	23824327
MIRT612106	hsa-miR-4445-5p	HITS-CLIP	23824327
MIRT612105	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612104	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612103	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612102	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612111	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT612110	hsa-miR-508-3p	HITS-CLIP	23824327
MIRT612109	hsa-miR-219a-5p	HITS-CLIP	23824327
MIRT612108	hsa-miR-4782-3p	HITS-CLIP	23824327
MIRT612107	hsa-miR-6766-3p	HITS-CLIP	23824327
MIRT612106	hsa-miR-4445-5p	HITS-CLIP	23824327
MIRT612105	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612104	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612103	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612102	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT624359	hsa-miR-4728-3p	HITS-CLIP	23824327
MIRT612111	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT612110	hsa-miR-508-3p	HITS-CLIP	23824327
MIRT612109	hsa-miR-219a-5p	HITS-CLIP	23824327
MIRT612108	hsa-miR-4782-3p	HITS-CLIP	23824327
MIRT612107	hsa-miR-6766-3p	HITS-CLIP	23824327
MIRT612106	hsa-miR-4445-5p	HITS-CLIP	23824327
MIRT624358	hsa-miR-8075	HITS-CLIP	23824327
MIRT612105	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612104	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612103	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612102	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT624357	hsa-miR-4428	HITS-CLIP	23824327
MIRT624356	hsa-miR-148a-5p	HITS-CLIP	23824327
MIRT624355	hsa-miR-6888-5p	HITS-CLIP	23824327
MIRT624354	hsa-miR-3973	HITS-CLIP	23824327
MIRT624353	hsa-miR-520g-3p	HITS-CLIP	23824327
MIRT624352	hsa-miR-520h	HITS-CLIP	23824327
MIRT624351	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT624350	hsa-miR-373-5p	HITS-CLIP	23824327
MIRT624349	hsa-miR-616-5p	HITS-CLIP	23824327
MIRT624348	hsa-miR-371a-5p	HITS-CLIP	23824327
MIRT624347	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT624346	hsa-miR-4522	HITS-CLIP	23824327
MIRT624345	hsa-miR-5186	HITS-CLIP	23824327
MIRT624344	hsa-miR-6079	HITS-CLIP	23824327
MIRT612111	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT612106	hsa-miR-4445-5p	HITS-CLIP	23824327
MIRT612105	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612104	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612103	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612102	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612111	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT612106	hsa-miR-4445-5p	HITS-CLIP	23824327
MIRT612105	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612104	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612103	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612102	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612111	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT612110	hsa-miR-508-3p	HITS-CLIP	23824327
MIRT612109	hsa-miR-219a-5p	HITS-CLIP	23824327
MIRT612108	hsa-miR-4782-3p	HITS-CLIP	23824327
MIRT612107	hsa-miR-6766-3p	HITS-CLIP	23824327
MIRT612106	hsa-miR-4445-5p	HITS-CLIP	23824327
MIRT612105	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612104	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612103	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612102	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT524479	hsa-miR-137	PAR-CLIP	21572407
MIRT524478	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT524477	hsa-miR-4643	PAR-CLIP	21572407
MIRT524476	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT524475	hsa-miR-466	PAR-CLIP	21572407
MIRT524474	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT524473	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT524472	hsa-miR-5590-5p	PAR-CLIP	21572407
MIRT524471	hsa-miR-4659a-5p	PAR-CLIP	21572407
MIRT524470	hsa-miR-4659b-5p	PAR-CLIP	21572407
MIRT524469	hsa-miR-4776-3p	PAR-CLIP	21572407
MIRT524468	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT524479	hsa-miR-137	PAR-CLIP	23446348
MIRT524478	hsa-miR-4789-3p	PAR-CLIP	23446348
MIRT524477	hsa-miR-4643	PAR-CLIP	23446348
MIRT524476	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT524475	hsa-miR-466	PAR-CLIP	23446348
MIRT524474	hsa-miR-4789-5p	PAR-CLIP	23446348
MIRT524473	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT524472	hsa-miR-5590-5p	PAR-CLIP	23446348
MIRT524471	hsa-miR-4659a-5p	PAR-CLIP	23446348
MIRT524470	hsa-miR-4659b-5p	PAR-CLIP	23446348
MIRT524469	hsa-miR-4776-3p	PAR-CLIP	23446348
MIRT524468	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT500184	hsa-miR-4311	PAR-CLIP	24398324
MIRT500182	hsa-miR-5197-3p	PAR-CLIP	24398324
MIRT500183	hsa-miR-6758-5p	PAR-CLIP	24398324
MIRT500181	hsa-miR-6856-5p	PAR-CLIP	24398324
MIRT500180	hsa-miR-6873-5p	PAR-CLIP	24398324
MIRT500179	hsa-miR-6760-5p	PAR-CLIP	24398324
MIRT500178	hsa-miR-4419a	PAR-CLIP	24398324
MIRT500177	hsa-miR-4510	PAR-CLIP	24398324
MIRT500176	hsa-miR-6127	PAR-CLIP	24398324
MIRT500175	hsa-miR-6129	PAR-CLIP	24398324
MIRT500173	hsa-miR-6130	PAR-CLIP	24398324
MIRT500174	hsa-miR-6133	PAR-CLIP	24398324
MIRT500172	hsa-miR-6878-5p	PAR-CLIP	24398324
MIRT500171	hsa-miR-2467-3p	PAR-CLIP	24398324
MIRT524478	hsa-miR-4789-3p	HITS-CLIP	21572407
MIRT524477	hsa-miR-4643	HITS-CLIP	21572407
MIRT524476	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT524475	hsa-miR-466	HITS-CLIP	21572407
MIRT524474	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT524473	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT524472	hsa-miR-5590-5p	HITS-CLIP	21572407
MIRT524471	hsa-miR-4659a-5p	HITS-CLIP	21572407
MIRT524470	hsa-miR-4659b-5p	HITS-CLIP	21572407
MIRT524469	hsa-miR-4776-3p	HITS-CLIP	21572407
MIRT524468	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT612111	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT612110	hsa-miR-508-3p	HITS-CLIP	23824327
MIRT612109	hsa-miR-219a-5p	HITS-CLIP	23824327
MIRT612108	hsa-miR-4782-3p	HITS-CLIP	23824327
MIRT612107	hsa-miR-6766-3p	HITS-CLIP	23824327
MIRT612106	hsa-miR-4445-5p	HITS-CLIP	23824327
MIRT612105	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612104	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612103	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612102	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612111	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT612110	hsa-miR-508-3p	HITS-CLIP	23824327
MIRT612109	hsa-miR-219a-5p	HITS-CLIP	23824327
MIRT612108	hsa-miR-4782-3p	HITS-CLIP	23824327
MIRT612107	hsa-miR-6766-3p	HITS-CLIP	23824327
MIRT612106	hsa-miR-4445-5p	HITS-CLIP	23824327
MIRT612105	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612104	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612103	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612102	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612111	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT612110	hsa-miR-508-3p	HITS-CLIP	23824327
MIRT612109	hsa-miR-219a-5p	HITS-CLIP	23824327
MIRT612108	hsa-miR-4782-3p	HITS-CLIP	23824327
MIRT612107	hsa-miR-6766-3p	HITS-CLIP	23824327
MIRT612106	hsa-miR-4445-5p	HITS-CLIP	23824327
MIRT612105	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612104	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612103	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612102	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612111	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT612110	hsa-miR-508-3p	HITS-CLIP	23824327
MIRT612109	hsa-miR-219a-5p	HITS-CLIP	23824327
MIRT612108	hsa-miR-4782-3p	HITS-CLIP	23824327
MIRT612107	hsa-miR-6766-3p	HITS-CLIP	23824327
MIRT612106	hsa-miR-4445-5p	HITS-CLIP	23824327
MIRT612105	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612104	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612103	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612102	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612111	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT612110	hsa-miR-508-3p	HITS-CLIP	23824327
MIRT612109	hsa-miR-219a-5p	HITS-CLIP	23824327
MIRT612108	hsa-miR-4782-3p	HITS-CLIP	23824327
MIRT612107	hsa-miR-6766-3p	HITS-CLIP	23824327
MIRT612106	hsa-miR-4445-5p	HITS-CLIP	23824327
MIRT612105	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612104	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612103	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612102	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612111	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT612110	hsa-miR-508-3p	HITS-CLIP	23824327
MIRT612109	hsa-miR-219a-5p	HITS-CLIP	23824327
MIRT612108	hsa-miR-4782-3p	HITS-CLIP	23824327
MIRT612107	hsa-miR-6766-3p	HITS-CLIP	23824327
MIRT612106	hsa-miR-4445-5p	HITS-CLIP	23824327
MIRT612105	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612104	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612103	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612102	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612111	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT612110	hsa-miR-508-3p	HITS-CLIP	23824327
MIRT612109	hsa-miR-219a-5p	HITS-CLIP	23824327
MIRT612108	hsa-miR-4782-3p	HITS-CLIP	23824327
MIRT612107	hsa-miR-6766-3p	HITS-CLIP	23824327
MIRT612106	hsa-miR-4445-5p	HITS-CLIP	23824327
MIRT612105	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612104	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612103	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612102	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT624359	hsa-miR-4728-3p	HITS-CLIP	23824327
MIRT612111	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT612110	hsa-miR-508-3p	HITS-CLIP	23824327
MIRT612109	hsa-miR-219a-5p	HITS-CLIP	23824327
MIRT612108	hsa-miR-4782-3p	HITS-CLIP	23824327
MIRT612107	hsa-miR-6766-3p	HITS-CLIP	23824327
MIRT612106	hsa-miR-4445-5p	HITS-CLIP	23824327
MIRT624358	hsa-miR-8075	HITS-CLIP	23824327
MIRT612105	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612104	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612103	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612102	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT624357	hsa-miR-4428	HITS-CLIP	23824327
MIRT624356	hsa-miR-148a-5p	HITS-CLIP	23824327
MIRT624355	hsa-miR-6888-5p	HITS-CLIP	23824327
MIRT624354	hsa-miR-3973	HITS-CLIP	23824327
MIRT624353	hsa-miR-520g-3p	HITS-CLIP	23824327
MIRT624352	hsa-miR-520h	HITS-CLIP	23824327
MIRT624351	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT624350	hsa-miR-373-5p	HITS-CLIP	23824327
MIRT624349	hsa-miR-616-5p	HITS-CLIP	23824327
MIRT624348	hsa-miR-371a-5p	HITS-CLIP	23824327
MIRT624347	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT624346	hsa-miR-4522	HITS-CLIP	23824327
MIRT624345	hsa-miR-5186	HITS-CLIP	23824327
MIRT624344	hsa-miR-6079	HITS-CLIP	23824327
MIRT612111	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT612106	hsa-miR-4445-5p	HITS-CLIP	23824327
MIRT612105	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612104	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612103	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612102	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612111	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT612106	hsa-miR-4445-5p	HITS-CLIP	23824327
MIRT612105	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612104	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612103	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612102	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612111	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT612110	hsa-miR-508-3p	HITS-CLIP	23824327
MIRT612109	hsa-miR-219a-5p	HITS-CLIP	23824327
MIRT612108	hsa-miR-4782-3p	HITS-CLIP	23824327
MIRT612107	hsa-miR-6766-3p	HITS-CLIP	23824327
MIRT612106	hsa-miR-4445-5p	HITS-CLIP	23824327
MIRT612105	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612104	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612103	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612102	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT524479	hsa-miR-137	PAR-CLIP	21572407
MIRT524478	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT524477	hsa-miR-4643	PAR-CLIP	21572407
MIRT524476	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT524475	hsa-miR-466	PAR-CLIP	21572407
MIRT524474	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT524473	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT524472	hsa-miR-5590-5p	PAR-CLIP	21572407
MIRT524471	hsa-miR-4659a-5p	PAR-CLIP	21572407
MIRT524470	hsa-miR-4659b-5p	PAR-CLIP	21572407
MIRT524469	hsa-miR-4776-3p	PAR-CLIP	21572407
MIRT524468	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT524479	hsa-miR-137	PAR-CLIP	23446348
MIRT524478	hsa-miR-4789-3p	PAR-CLIP	23446348
MIRT524477	hsa-miR-4643	PAR-CLIP	23446348
MIRT524476	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT524475	hsa-miR-466	PAR-CLIP	23446348
MIRT524474	hsa-miR-4789-5p	PAR-CLIP	23446348
MIRT524473	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT524472	hsa-miR-5590-5p	PAR-CLIP	23446348
MIRT524471	hsa-miR-4659a-5p	PAR-CLIP	23446348
MIRT524470	hsa-miR-4659b-5p	PAR-CLIP	23446348
MIRT524469	hsa-miR-4776-3p	PAR-CLIP	23446348
MIRT524468	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT500184	hsa-miR-4311	PAR-CLIP	24398324
MIRT500182	hsa-miR-5197-3p	PAR-CLIP	24398324
MIRT500183	hsa-miR-6758-5p	PAR-CLIP	24398324
MIRT500181	hsa-miR-6856-5p	PAR-CLIP	24398324
MIRT500180	hsa-miR-6873-5p	PAR-CLIP	24398324
MIRT500179	hsa-miR-6760-5p	PAR-CLIP	24398324
MIRT500178	hsa-miR-4419a	PAR-CLIP	24398324
MIRT500177	hsa-miR-4510	PAR-CLIP	24398324
MIRT500176	hsa-miR-6127	PAR-CLIP	24398324
MIRT500175	hsa-miR-6129	PAR-CLIP	24398324
MIRT500173	hsa-miR-6130	PAR-CLIP	24398324
MIRT500174	hsa-miR-6133	PAR-CLIP	24398324
MIRT500172	hsa-miR-6878-5p	PAR-CLIP	24398324
MIRT500171	hsa-miR-2467-3p	PAR-CLIP	24398324
MIRT891653	hsa-miR-30a	CLIP-seq
MIRT891654	hsa-miR-30b	CLIP-seq
MIRT891655	hsa-miR-30c	CLIP-seq
MIRT891656	hsa-miR-30d	CLIP-seq
MIRT891657	hsa-miR-30e	CLIP-seq
MIRT891658	hsa-miR-4514	CLIP-seq
MIRT891659	hsa-miR-4692	CLIP-seq
MIRT1964266	hsa-miR-668	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004435	Function	Phosphatidylinositol-4,5-bisphosphate phospholipase C activity	IEA
GO:0004435	Function	Phosphatidylinositol-4,5-bisphosphate phospholipase C activity	TAS	1905013
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	19575010, 20398705, 21056967
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	21056967
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	3443095, 9547368
GO:0006939	Process	Smooth muscle contraction	IEA
GO:0006940	Process	Regulation of smooth muscle contraction	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	10940357
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	9603968
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA
GO:0007197	Process	Adenylate cyclase-inhibiting G protein-coupled acetylcholine receptor signaling pathway	IBA
GO:0007207	Process	Phospholipase C-activating G protein-coupled acetylcholine receptor signaling pathway	IEA
GO:0007213	Process	G protein-coupled acetylcholine receptor signaling pathway	ISS
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0007271	Process	Synaptic transmission, cholinergic	IEA
GO:0007399	Process	Nervous system development	TAS	2739737
GO:0009925	Component	Basal plasma membrane	IDA	17478539
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016907	Function	G protein-coupled acetylcholine receptor activity	IBA
GO:0016907	Function	G protein-coupled acetylcholine receptor activity	IEA
GO:0016907	Function	G protein-coupled acetylcholine receptor activity	ISS
GO:0016907	Function	G protein-coupled acetylcholine receptor activity	TAS	9547368
GO:0019722	Process	Calcium-mediated signaling	IDA	17478539
GO:0030425	Component	Dendrite	IBA
GO:0032024	Process	Positive regulation of insulin secretion	IEA
GO:0036211	Process	Protein modification process	TAS	10051746
GO:0038023	Function	Signaling receptor activity	IEA
GO:0038023	Function	Signaling receptor activity	TAS	10940357
GO:0042166	Function	Acetylcholine binding	ISS
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045987	Process	Positive regulation of smooth muscle contraction	IEA
GO:0045987	Process	Positive regulation of smooth muscle contraction	IEA
GO:0046541	Process	Saliva secretion	IEA
GO:0046541	Process	Saliva secretion	IEA
GO:0095500	Process	Acetylcholine receptor signaling pathway	IDA	17478539
GO:0095500	Process	Acetylcholine receptor signaling pathway	IEA
GO:1990806	Process	Ligand-gated ion channel signaling pathway	IEA

Other IDs

• MIM: 118494
• HGNC: 1952
• e!Ensembl: ENSG00000133019

Protein

• UniProt ID: P20309
• Protein name: Muscarinic acetylcholine receptor M3
• Protein function: The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effec
• PDB: 2CSA, 8E9W, 8E9Y, 8E9Z, 8EA0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	85 → 544	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPL
  GGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVI
  SMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR
  TTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF
  YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM
  KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE
  TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSF
  PKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKR
  MSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVN
  PVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL

• Sequence length: 590

Pathways

KEGG:

Calcium signaling pathway
Neuroactive ligand-receptor interaction
Cholinergic synapse
Taste transduction
Regulation of actin cytoskeleton
Insulin secretion
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Alzheimer disease
Pathways of neurodegeneration - multiple diseases

Reactome:

Muscarinic acetylcholine receptors
G alpha (q) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Prune belly syndrome	Pathogenic	rs587776862, rs1680093659	RCV000022466 RCV001251074	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRM3-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRYPTORCHIDISM	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENERALISED EPILEPSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Abdominal Cryptorchidism	Cryptorchidism	CTD_human_DG	22077972		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	30655906		★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	30655906		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	28416748		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	28416748, 30682058		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	30682058		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	27876571		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30655906		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	20553297, 30851701		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	22186213		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36475335	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyloidosis	Amyloidosis	BEFREE	23036020, 31194989		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	27537102		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31177911		★☆☆☆☆ Found in Text Mining only
Anus, Imperforate	Imperforate anus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	31286259		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	31286259		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	22038107, 27825159, 29257234, 30039147		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	16793145, 29952027		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12642833, 17656681, 22192964, 24365139, 24430298, 28166213, 29600329		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	12642833		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	28166213	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	16280122	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	22038107, 27825159, 29257234, 30039147		★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	HPO_DG			★☆☆☆☆ Found in Text Mining only
Atypical Teratoid Rhabdoid Tumor	Teratoid Rhabdoid Tumor	BEFREE	28878397, 29408713		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	23253743		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	27167157, 30804810		★☆☆☆☆ Found in Text Mining only
Bilateral Cryptorchidism	Cryptorchidism	CTD_human_DG	22077972		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	23962466		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28053981		★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	22192964		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25964092, 36919835	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28053981		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31862408	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	30126637		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29039441, 29221142		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	30655906		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	28619712		★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	31602208		★☆☆☆☆ Found in Text Mining only
Chronic interstitial cystitis	Interstitial Cystitis	BEFREE	16482998		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	22192964, 26633752, 28166213, 29630123		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	30804561		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	BEFREE	31325218		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21273532, 26919111, 28416748, 30841571		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	24694019, 28416748		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23704319, 27876571		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21273532, 28416748, 36919835	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	27876571		★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	31695336		★☆☆☆☆ Found in Text Mining only
Congenital clubfoot	Congenital Clubfoot	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital Dysplasia Of The Hip	Developmental dysplasia of the hip	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital malrotation of intestine	Congenital malrotation of intestine	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital pectus carinatum	Congenital Pectus Carinatum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital pectus excavatum	Congenital Pectus Excavatum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital posterior urethral valves	Congenital Posterior Urethral Valves	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31602208		★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	29207076		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	CTD_human_DG	22077972		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cryptorchidism	Cryptorchidism	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	28427476		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	25804706, 29877096		★☆☆☆☆ Found in Text Mining only
Defect of vertebral segmentation	Abnormal spinal segmentation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31486697		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	25144571		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28813174		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	30219690	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	30718736		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	19931306, 28779211		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	19931306, 28779211, 29896433		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	29063670, 30212220, 31082775, 31534524		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17130513, 31394992		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	29660008		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	22022585		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	Pubtator	22022585	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	GWASCAT_DG	22949513		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	GWASDB_DG	22949513		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fibrosis, Liver	Liver Fibrosis	CTD_human_DG	20197374		★☆☆☆☆ Found in Text Mining only
Geographic Atrophy	Geographic Atrophy	BEFREE	28241319		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	19589205		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	19589205		★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	28615039		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	21147892		★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	BEFREE	31740666		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	23317008, 30196290		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	23271126		★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	21336576, 30911550		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	38010846	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	30955929		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	31862408	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	HPO_DG			★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	30718736		★☆☆☆☆ Found in Text Mining only
Intestinal Atresia	Intestinal Atresia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	24694019		★☆☆☆☆ Found in Text Mining only
Intestinal Volvulus	Intestinal Volvulus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	28888778		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28688148		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	30655906		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30655906		★☆☆☆☆ Found in Text Mining only
Lipodystrophy Congenital Generalized	Lipodystrophy	Pubtator	32349771	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22569271, 29200736, 29491636, 31370114		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	CTD_human_DG	20197374		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Failure	Liver failure	Pubtator	36111745	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	29200736		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	30753240, 30967859		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	28719617		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	28719617		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28719617		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	28719617		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	23962466		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	GWASCAT_DG	30219690		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	29504577		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28181819		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26071486, 27606721, 29309643, 30483762, 31165705		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26919111		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28053981		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28416748, 29184131, 29504577, 31322969, 31618604		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21273532, 26919111, 28416748, 29357811, 30841571		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16055751		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	18422974		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31382579		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28813174		★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, X-LINKED, SNYDER-ROBINSON TYPE	Mental retardation	BEFREE	30790741		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	18375821		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	23962466		★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis III	Mucopolysaccharidosis	BEFREE	29916295		★☆☆☆☆ Found in Text Mining only
Multicystic Dysplastic Kidney	Multicystic renal dysplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	21346779	Associate	★☆☆☆☆ Found in Text Mining only
MUTYH-Associate Polyposis	Polyposis	BEFREE	25144571, 30382823		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	17445769, 18640847, 21035182, 23692382, 25679992, 28499885, 28929261, 29042955, 30232729, 31249602, 31299609, 31629738		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	22899762		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	25349937		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	25227792		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	29661576, 29699808		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10416589, 10527073, 10849552, 11177556, 11285029, 12481437, 12888890, 14707272, 15499380, 15797967, 16570242, 18375821, 19587531, 20127013, 20727927, 22091632, 22471469, 22569271, 23055194, 23621188, 24694019, 25051350, 26900913, 27537102, 27876571, 28181819, 28243324, 28416748, 28750318, 28845591, 28983587, 29309643, 29332347, 29420012, 29434973, 29745953, 30084800, 30158369, 30274038, 30464463, 30586442, 30824610, 30851455, 30945134, 31161657, 31499268, 31520101, 31571927, 31576881, 31584324, 31664821, 31789402, 9458076		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	30824610		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30905315		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25964092		★☆☆☆☆ Found in Text Mining only
Nonarteritic anterior ischemic optic neuropathy (NAION)	Nonarteritic Anterior Ischemic Optic Neuropathy	BEFREE	30273053		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	31740666		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	30663793		★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Osteogenesis Imperfecta	BEFREE	29764212		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30635919		★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	31034039		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33997040, 39355254	Associate	★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	16482998, 29029615, 29348862, 30212220, 31762937		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28181819		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	31177911		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	31692054		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29200724, 29989488, 31060423		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	BEFREE	24841412		★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	30797663		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	30655906		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	31747477		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	31747477		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26071486, 27606721, 29309643, 30483762, 31165705		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30483762, 32205868, 36754848	Associate	★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	22077972, 29029615, 29348862, 30212220, 31762937		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Prune Belly Syndrome	Prune belly syndrome	ORPHANET_DG	22077972		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Prune Belly Syndrome	Prune belly syndrome	CTD_human_DG	22077972		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Prune belly syndrome	Prune belly syndrome	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Prune Belly Syndrome	Prune belly syndrome	HPO_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Prune Belly Syndrome	Prune belly syndrome	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Psychotic Disorders	Psychosis	BEFREE	31740666		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	28166213, 30214182	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	24918270		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Insufficiency	Renal Insufficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	28901469, 29965781		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	16167344, 29803741		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	LHGDN	17951979		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	31486697		★☆☆☆☆ Found in Text Mining only
Russell-Silver syndrome	Russell-Silver Syndrome	BEFREE	30790741		★☆☆☆☆ Found in Text Mining only
Salivary Gland Pleomorphic Adenoma	Pleomorphic adenoma of salivary gland	BEFREE	29109762		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	26959877		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scoliosis, unspecified	Scoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30521844		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	36017844	Associate	★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	27770950		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	2153134	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15240543		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26919111		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26919111, 35673819	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	31461955		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	28855694		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	HPO_DG			★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	29042811		★☆☆☆☆ Found in Text Mining only
Unilateral Cryptorchidism	Cryptorchidism	CTD_human_DG	22077972		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	23962466		★☆☆☆☆ Found in Text Mining only
Urethral obstruction sequence	Urethral Obstruction	ORPHANET_DG	22077972		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary Bladder Diseases	BEFREE	22077972, 31441039		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Diseases	Urinary Bladder Diseases	CTD_human_DG	22077972		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	31441039	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28053981	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Anomalies	Uterine Anomalies	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	25360679		★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	HPO_DG			★☆☆☆☆ Found in Text Mining only
Vesico-Ureteral Reflux	Vesicoureteral Reflux	HPO_DG			★☆☆☆☆ Found in Text Mining only
Zellweger Syndrome	Zellweger Syndrome	BEFREE	1639130		★☆☆☆☆ Found in Text Mining only