Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	11309
Gene name	Solute carrier organic anion transporter family member 2B1
Gene symbol	SLCO2B1
Synonyms (NCBI Gene)	OATP-BOATP2B1OATPBSLC21A9
Chromosome	11
Chromosome location	11q13.4
Summary	This locus encodes a member of the organic anion-transporting polypeptide family of membrane proteins. The protein encoded by this locus may function in regulation of placental uptake of sulfated steroids. Alternatively spliced transcript variants have be

146

Show/Hide all (146)

miRTarBase ID	miRNA	Experiments	Reference
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT504692	hsa-miR-4673	PAR-CLIP	20371350
MIRT504691	hsa-miR-640	PAR-CLIP	20371350
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT504692	hsa-miR-4673	PAR-CLIP	20371350
MIRT504691	hsa-miR-640	PAR-CLIP	20371350
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT504692	hsa-miR-4673	PAR-CLIP	20371350
MIRT504691	hsa-miR-640	PAR-CLIP	20371350
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT504692	hsa-miR-4673	PAR-CLIP	20371350
MIRT504691	hsa-miR-640	PAR-CLIP	20371350
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	21572407
MIRT504692	hsa-miR-4673	PAR-CLIP	21572407
MIRT504691	hsa-miR-640	PAR-CLIP	21572407
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	22012620
MIRT504692	hsa-miR-4673	PAR-CLIP	22012620
MIRT504691	hsa-miR-640	PAR-CLIP	22012620
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	23446348
MIRT504692	hsa-miR-4673	PAR-CLIP	23446348
MIRT504691	hsa-miR-640	PAR-CLIP	23446348
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	23446348
MIRT504692	hsa-miR-4673	PAR-CLIP	23446348
MIRT504691	hsa-miR-640	PAR-CLIP	23446348
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	23446348
MIRT504692	hsa-miR-4673	PAR-CLIP	23446348
MIRT504691	hsa-miR-640	PAR-CLIP	23446348
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	23446348
MIRT504692	hsa-miR-4673	PAR-CLIP	23446348
MIRT504691	hsa-miR-640	PAR-CLIP	23446348
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	26701625
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	26701625
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	26701625
MIRT504692	hsa-miR-4673	PAR-CLIP	26701625
MIRT504692	hsa-miR-4673	PAR-CLIP	26701625
MIRT504692	hsa-miR-4673	PAR-CLIP	26701625
MIRT504691	hsa-miR-640	PAR-CLIP	26701625
MIRT504691	hsa-miR-640	PAR-CLIP	26701625
MIRT504691	hsa-miR-640	PAR-CLIP	26701625
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	27292025
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	27292025
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	27292025
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	27292025
MIRT504692	hsa-miR-4673	PAR-CLIP	27292025
MIRT504692	hsa-miR-4673	PAR-CLIP	27292025
MIRT504692	hsa-miR-4673	PAR-CLIP	27292025
MIRT504692	hsa-miR-4673	PAR-CLIP	27292025
MIRT504691	hsa-miR-640	PAR-CLIP	27292025
MIRT504691	hsa-miR-640	PAR-CLIP	27292025
MIRT504691	hsa-miR-640	PAR-CLIP	27292025
MIRT504691	hsa-miR-640	PAR-CLIP	27292025
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT504692	hsa-miR-4673	PAR-CLIP	20371350
MIRT504691	hsa-miR-640	PAR-CLIP	20371350
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT504692	hsa-miR-4673	PAR-CLIP	20371350
MIRT504691	hsa-miR-640	PAR-CLIP	20371350
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT504692	hsa-miR-4673	PAR-CLIP	20371350
MIRT504691	hsa-miR-640	PAR-CLIP	20371350
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT504692	hsa-miR-4673	PAR-CLIP	20371350
MIRT504691	hsa-miR-640	PAR-CLIP	20371350
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	21572407
MIRT504692	hsa-miR-4673	PAR-CLIP	21572407
MIRT504691	hsa-miR-640	PAR-CLIP	21572407
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	22012620
MIRT504692	hsa-miR-4673	PAR-CLIP	22012620
MIRT504691	hsa-miR-640	PAR-CLIP	22012620
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	23446348
MIRT504692	hsa-miR-4673	PAR-CLIP	23446348
MIRT504691	hsa-miR-640	PAR-CLIP	23446348
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	23446348
MIRT504692	hsa-miR-4673	PAR-CLIP	23446348
MIRT504691	hsa-miR-640	PAR-CLIP	23446348
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	23446348
MIRT504692	hsa-miR-4673	PAR-CLIP	23446348
MIRT504691	hsa-miR-640	PAR-CLIP	23446348
MIRT504693	hsa-miR-4645-5p	PAR-CLIP	23446348
MIRT504692	hsa-miR-4673	PAR-CLIP	23446348
MIRT504691	hsa-miR-640	PAR-CLIP	23446348
MIRT1369340	hsa-miR-1915	CLIP-seq
MIRT1369341	hsa-miR-204	CLIP-seq
MIRT1369342	hsa-miR-211	CLIP-seq
MIRT1369343	hsa-miR-3182	CLIP-seq
MIRT1369344	hsa-miR-3686	CLIP-seq
MIRT1369345	hsa-miR-3918	CLIP-seq
MIRT1369346	hsa-miR-4287	CLIP-seq
MIRT1369347	hsa-miR-4685-3p	CLIP-seq
MIRT1369348	hsa-miR-4685-5p	CLIP-seq
MIRT1369349	hsa-miR-499a-5p	CLIP-seq
MIRT1369350	hsa-miR-3145-3p	CLIP-seq
MIRT1369351	hsa-miR-4330	CLIP-seq
MIRT1369352	hsa-miR-4477a	CLIP-seq
MIRT1369340	hsa-miR-1915	CLIP-seq
MIRT1369345	hsa-miR-3918	CLIP-seq
MIRT1369348	hsa-miR-4685-5p	CLIP-seq
MIRT1369349	hsa-miR-499a-5p	CLIP-seq
MIRT1369340	hsa-miR-1915	CLIP-seq
MIRT1369345	hsa-miR-3918	CLIP-seq
MIRT1369348	hsa-miR-4685-5p	CLIP-seq
MIRT1369349	hsa-miR-499a-5p	CLIP-seq
MIRT1369340	hsa-miR-1915	CLIP-seq
MIRT1369345	hsa-miR-3918	CLIP-seq
MIRT1369348	hsa-miR-4685-5p	CLIP-seq
MIRT1369349	hsa-miR-499a-5p	CLIP-seq
MIRT1369340	hsa-miR-1915	CLIP-seq
MIRT1369345	hsa-miR-3918	CLIP-seq
MIRT1369348	hsa-miR-4685-5p	CLIP-seq
MIRT1369349	hsa-miR-499a-5p	CLIP-seq
MIRT1369340	hsa-miR-1915	CLIP-seq
MIRT1369345	hsa-miR-3918	CLIP-seq
MIRT1369348	hsa-miR-4685-5p	CLIP-seq
MIRT1369349	hsa-miR-499a-5p	CLIP-seq
MIRT2440556	hsa-miR-4493	CLIP-seq
MIRT2440557	hsa-miR-4635	CLIP-seq
MIRT2440558	hsa-miR-4650-5p	CLIP-seq
MIRT2440559	hsa-miR-4757-5p	CLIP-seq
MIRT1369341	hsa-miR-204	CLIP-seq
MIRT1369342	hsa-miR-211	CLIP-seq
MIRT2627308	hsa-miR-2681	CLIP-seq
MIRT2627309	hsa-miR-299-3p	CLIP-seq
MIRT2627310	hsa-miR-3153	CLIP-seq
MIRT2627311	hsa-miR-3607-5p	CLIP-seq
MIRT2627312	hsa-miR-4648	CLIP-seq
MIRT2627313	hsa-miR-4654	CLIP-seq
MIRT2627314	hsa-miR-4668-5p	CLIP-seq
MIRT2627315	hsa-miR-4769-5p	CLIP-seq
MIRT2691330	hsa-miR-125a-5p	CLIP-seq
MIRT2691331	hsa-miR-125b	CLIP-seq
MIRT1369341	hsa-miR-204	CLIP-seq
MIRT1369342	hsa-miR-211	CLIP-seq
MIRT2627308	hsa-miR-2681	CLIP-seq
MIRT2627309	hsa-miR-299-3p	CLIP-seq
MIRT2627310	hsa-miR-3153	CLIP-seq
MIRT2627311	hsa-miR-3607-5p	CLIP-seq
MIRT2691332	hsa-miR-3616-3p	CLIP-seq
MIRT2691333	hsa-miR-4319	CLIP-seq
MIRT2627312	hsa-miR-4648	CLIP-seq
MIRT2627313	hsa-miR-4654	CLIP-seq
MIRT2627314	hsa-miR-4668-5p	CLIP-seq
MIRT2691334	hsa-miR-4721	CLIP-seq
MIRT2691335	hsa-miR-4732-3p	CLIP-seq
MIRT2627315	hsa-miR-4769-5p	CLIP-seq
MIRT2691336	hsa-miR-544b	CLIP-seq
MIRT2691337	hsa-miR-670	CLIP-seq

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005886	Component	Plasma membrane	IDA	21278488, 29752999, 29871943
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	IDA	10873595, 11159893, 11932330, 12409283, 12724351, 14610227, 16908597, 18501590, 19129463, 22021325, 22201122, 26383540, 27576593, 34628357
GO:0008514	Function	Organic anion transmembrane transporter activity	IMP	29871943
GO:0009925	Component	Basal plasma membrane	IDA	11159893, 11932330, 12409283, 12724351, 35307651
GO:0009925	Component	Basal plasma membrane	IEA
GO:0015125	Function	Bile acid transmembrane transporter activity	IBA
GO:0015132	Function	Prostaglandin transmembrane transporter activity	IDA	10873595
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	IBA
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	IDA	18501590
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	TAS
GO:0015711	Process	Organic anion transport	IDA	12724351, 22021325
GO:0015721	Process	Bile acid and bile salt transport	IBA
GO:0015732	Process	Prostaglandin transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IBA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	IBA
GO:0016324	Component	Apical plasma membrane	IDA	12724351
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	ISS	18619525
GO:0022857	Function	Transmembrane transporter activity	IDA	25132355
GO:0042167	Process	Heme catabolic process	TAS
GO:0043252	Process	Sodium-independent organic anion transport	IBA
GO:0043252	Process	Sodium-independent organic anion transport	TAS
GO:0055085	Process	Transmembrane transport	IDA	12724351, 29871943
GO:0055085	Process	Transmembrane transport	IEA
GO:0055085	Process	Transmembrane transport	IMP	29752999
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653

MIM	HGNC	e!Ensembl
604988	10962	ENSG00000137491

O94956

Protein name

Solute carrier organic anion transporter family member 2B1 (Organic anion transporter B) (OATP-B) (Organic anion transporter polypeptide-related protein 2) (OATP-RP2) (OATPRP2) (Organic anion transporting polypeptide 2B1) (OATP2B1) (Solute carrier family

Protein function

Mediates the Na(+)-independent transport of steroid sulfate conjugates and other specific organic anions (PubMed:10873595, PubMed:11159893, PubMed:11932330, PubMed:12724351, PubMed:14610227, PubMed:16908597, PubMed:18501590, PubMed:20507927, Pub

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03137	OATP	50 → 647	Organic Anion Transporter Polypeptide (OATP) family	Family

Tissue specificity

TISSUE SPECIFICITY: Strongly expressed in the liver, at the sinusoidal membrane of the hepatocytes (PubMed:10873595, PubMed:11159893, PubMed:23531488). Expressed in the kidney (PubMed:11159893). Expressed in placental trophoblasts and syncytiotrophoblast

Sequence

MGPRIGPAGEVPQVPDKETKATMGTENTPGGKASPDPQDVRPSVFHNIKLFVLCHSLLQL
AQLMISGYLKSSISTVEKRFGLSSQTSGLLASFNEVGNTALIVFVSYFGSRVHRPRMIGY
GAILVALAGLLMTLPHFISEPYRYDNTSPEDMPQDFKASLCLPTTSAPASAPSNGNCSSY
TETQHLSVVGIMFVAQTLLGVGGVPIQPFGISYIDDFAHNSNSPLYLGILFAVTMMGPGL
AFGLGSLMLRLYVDINQMPEGGISLTIKDPRWVGAWWLGFLIAAGAVALAAIPYFFFPKE
MPKEKRELQFRRKVLAVTDSPARKGKDSPSKQSPGESTKKQDGLVQIAPNLTVIQFIKVF
PRVLLQTLRHPIFLLVVLSQVCLSSMAAGMAIFLPKFLERQFSITASYANLLIGCLSFPS
VIVGIVVGGVLVKRLHLGPVGCGALCLLGMLLCLFFSLPLFFIGCSSHQIAGITHQTSAH
PGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCS
CVVEGNPVLAGSCDSTCSHLVVPFLLLVSLGSALACLTHTPSFMLILRGVKKEDKTLAVG
IQFMFLRILAWMPSPVIHGSAIDTTCVHWALSCGRRAVCRYYNNDLLRNRFIGLQFFFKT
GSVICFALVLAVLRQQDKEARTKESRSSPAVEQQLLVSGPGKKPEDSRV

Sequence length

709

Interactions

View interactions

	KEGG		Reactome
	Folate transport and metabolism		Heme degradation Transport of organic anions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atorvastatin response	-	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (46)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	31545446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	19151602	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	29749828		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	24762081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17214375, 20635135, 21278488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17214375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21625523, 23352986, 29138286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	24762081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33428598	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Cerebellar ataxia and hypogonadotropic hypogonadism	Pubtator	32147459	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	31664047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30586693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34599518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31467884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29534510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29534510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31269743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	29724294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	28097795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28097795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	33255902	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular degeneration	Pubtator	34117631	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	28627804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	19487253	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	31664047	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	31664047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31467884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17214375, 20635135, 21278488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	21625523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21625523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21266523, 21606417, 23896625, 26668348, 28389510, 29581838, 30890759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	21625523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	24762081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	28771594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29581838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	25857231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21625523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21625523	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21266523, 21606417, 23896625, 26668348, 28389510, 29581838, 30890759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21266523, 21606417, 26668348, 28389510, 30890759	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23137910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23137910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	21625523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	21625523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	21625523	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SLCO2B1 (solute carrier organic anion transporter family member 2B1)