CHRM2 (cholinergic receptor muscarinic 2)

Gene

• Entrez ID: 1129
• Gene name: Cholinergic receptor muscarinic 2
• Gene symbol: CHRM2
• Synonyms (NCBI Gene): HM2
• Chromosome: 7
• Chromosome location: 7q33
• Summary: The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine to these receptors and includes cellular responses such as adenylate cycl

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017560	hsa-miR-335-5p	Microarray	18185580
MIRT617798	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT617797	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT617796	hsa-miR-29b-2-5p	HITS-CLIP	23824327
MIRT617795	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT617794	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT617793	hsa-miR-659-3p	HITS-CLIP	23824327
MIRT617797	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT617796	hsa-miR-29b-2-5p	HITS-CLIP	23824327
MIRT617795	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT617794	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT617793	hsa-miR-659-3p	HITS-CLIP	23824327
MIRT617792	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT617798	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT617797	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT617796	hsa-miR-29b-2-5p	HITS-CLIP	23824327
MIRT617795	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT617794	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT617793	hsa-miR-659-3p	HITS-CLIP	23824327
MIRT617792	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT617791	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT735110	hsa-miR-17-5p	qRT-PCR	31776299
MIRT735112	hsa-miR-582-3p	qRT-PCR	31776299
MIRT735121	hsa-miR-378a-5p	qRT-PCR	31776299
MIRT617798	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT617797	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT617796	hsa-miR-29b-2-5p	HITS-CLIP	23824327
MIRT617795	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT617794	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT617793	hsa-miR-659-3p	HITS-CLIP	23824327
MIRT617797	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT617796	hsa-miR-29b-2-5p	HITS-CLIP	23824327
MIRT617795	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT617794	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT617793	hsa-miR-659-3p	HITS-CLIP	23824327
MIRT617792	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT617798	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT617797	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT617796	hsa-miR-29b-2-5p	HITS-CLIP	23824327
MIRT617795	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT617794	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT617793	hsa-miR-659-3p	HITS-CLIP	23824327
MIRT617792	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT617791	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT891626	hsa-miR-18a	CLIP-seq
MIRT891627	hsa-miR-18b	CLIP-seq
MIRT891628	hsa-miR-200b	CLIP-seq
MIRT891629	hsa-miR-200c	CLIP-seq
MIRT891630	hsa-miR-3140-5p	CLIP-seq
MIRT891631	hsa-miR-335	CLIP-seq
MIRT891632	hsa-miR-3660	CLIP-seq
MIRT891633	hsa-miR-378g	CLIP-seq
MIRT891634	hsa-miR-4268	CLIP-seq
MIRT891635	hsa-miR-429	CLIP-seq
MIRT891636	hsa-miR-4437	CLIP-seq
MIRT891637	hsa-miR-4448	CLIP-seq
MIRT891638	hsa-miR-450b-5p	CLIP-seq
MIRT891639	hsa-miR-4526	CLIP-seq
MIRT891640	hsa-miR-4645-3p	CLIP-seq
MIRT891641	hsa-miR-4674	CLIP-seq
MIRT891642	hsa-miR-4712-3p	CLIP-seq
MIRT891643	hsa-miR-4731-5p	CLIP-seq
MIRT891644	hsa-miR-4735-3p	CLIP-seq
MIRT891645	hsa-miR-4778-3p	CLIP-seq
MIRT891646	hsa-miR-507	CLIP-seq
MIRT891647	hsa-miR-539	CLIP-seq
MIRT891648	hsa-miR-557	CLIP-seq
MIRT891649	hsa-miR-592	CLIP-seq
MIRT891650	hsa-miR-595	CLIP-seq
MIRT891651	hsa-miR-597	CLIP-seq
MIRT891652	hsa-miR-668	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	24256733
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	3037705, 3443095
GO:0005929	Component	Cilium	IDA
GO:0006940	Process	Regulation of smooth muscle contraction	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	9603968
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	10895079
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	TAS	8139539
GO:0007197	Process	Adenylate cyclase-inhibiting G protein-coupled acetylcholine receptor signaling pathway	IBA
GO:0007197	Process	Adenylate cyclase-inhibiting G protein-coupled acetylcholine receptor signaling pathway	IDA	36690613
GO:0007207	Process	Phospholipase C-activating G protein-coupled acetylcholine receptor signaling pathway	TAS	2739737
GO:0007213	Process	G protein-coupled acetylcholine receptor signaling pathway	IDA	24256733, 36690613
GO:0007213	Process	G protein-coupled acetylcholine receptor signaling pathway	IEA
GO:0007213	Process	G protein-coupled acetylcholine receptor signaling pathway	IEA
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0007399	Process	Nervous system development	TAS	2739737
GO:0008016	Process	Regulation of heart contraction	IEA
GO:0008016	Process	Regulation of heart contraction	TAS	10544184
GO:0009615	Process	Response to virus	IEP	16548883
GO:0016020	Component	Membrane	IDA	11566136
GO:0016020	Component	Membrane	IEA
GO:0016907	Function	G protein-coupled acetylcholine receptor activity	IBA
GO:0016907	Function	G protein-coupled acetylcholine receptor activity	IDA	24256733, 36690613
GO:0016907	Function	G protein-coupled acetylcholine receptor activity	IEA
GO:0016907	Function	G protein-coupled acetylcholine receptor activity	TAS	9603968
GO:0030425	Component	Dendrite	IBA
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0036064	Component	Ciliary basal body	IDA
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098981	Component	Cholinergic synapse	IEA
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IEA
GO:1990763	Function	Arrestin family protein binding	IPI	11566136

Other IDs

• MIM: 118493
• HGNC: 1951
• e!Ensembl: ENSG00000181072

Protein

• UniProt ID: P08172
• Protein name: Muscarinic acetylcholine receptor M2
• Protein function: The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effec
• PDB: 3UON, 4MQS, 4MQT, 5YC8, 5ZK3, 5ZK8, 5ZKB, 5ZKC, 6OIK, 6U1N, 7T8X, 7T90, 7T94, 7T96, 8J8R, 8J97, 8JAF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	40 → 440	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
  FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
  RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
  FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI
  VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
  ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNI
  VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
  VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR

• Sequence length: 466

Pathways

KEGG:

Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Cholinergic synapse
Regulation of actin cytoskeleton

Reactome:

Muscarinic acetylcholine receptors
G alpha (i) signalling events
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRADYCARDIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHAGAS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRM2-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 1	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dilated Cardiomyopathy, Dominant	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSION, SINGLE EPISODE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE WITH AURA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECURRENT MAJOR DEPRESSIVE EPISODES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER, NEUROGENIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adult Medulloblastoma	Medulloblastoma	BEFREE	31539380		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	16181410	Associate	★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial personality disorder	Pubtator	21883161	Associate	★☆☆☆☆ Found in Text Mining only
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	18451336	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	11325793, 22370858, 24430298	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	12948933, 24430298		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asymmetric Diabetic Proximal Motor Neuropathy	Asymmetric Diabetic Proximal Motor Neuropathy	CTD_human_DG	20624991		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	21617318		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	21617318	Associate	★☆☆☆☆ Found in Text Mining only
Atrioventricular Block	Atrioventricular block	Pubtator	18451336	Associate	★☆☆☆☆ Found in Text Mining only
Awakening Epilepsy	Epilepsy	CTD_human_DG	18333967		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	28506859		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	20351719		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	20351719		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	20351719	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Borderline Personality Disorder	Borderline personality disorder	BEFREE	26630954		★☆☆☆☆ Found in Text Mining only
Brittle diabetes	Brittle diabetes mellitus	CTD_human_DG	18603373		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	26630954		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31862408	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	31539380		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	18451336	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	18451336		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Dilated	Cardiomyopathy	LHGDN	18451336		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	18451336		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	31539380		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	26633752		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35545337	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30282322		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	12116189, 15229186, 19181679, 20351719		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	12116189, 15229186, 19181679, 20351719		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	20351719	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Syndrome	Mental Depression	BEFREE	15229186, 16000316		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	18603373		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Ketosis-Prone	Diabetes Mellitus	CTD_human_DG	18603373		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Sudden-Onset	Diabetes Mellitus	CTD_human_DG	18603373		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	CTD_human_DG	18603373		★☆☆☆☆ Found in Text Mining only
Diabetic Amyotrophy	Diabetic Amyotrophy	CTD_human_DG	20624991		★☆☆☆☆ Found in Text Mining only
Diabetic Asymmetric Polyneuropathy	Diabetic Asymmetric Polyneuropathy	CTD_human_DG	20624991		★☆☆☆☆ Found in Text Mining only
Diabetic Autonomic Neuropathy	Diabetic Autonomic Neuropathy	CTD_human_DG	20624991		★☆☆☆☆ Found in Text Mining only
Diabetic Mononeuropathy	Diabetic Mononeuropathy	CTD_human_DG	20624991		★☆☆☆☆ Found in Text Mining only
Diabetic Neuralgia	Diabetic Neuralgia	CTD_human_DG	20624991		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	CTD_human_DG	20624991		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Polyneuropathies	Diabetic polyneuropathy	CTD_human_DG	20624991		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	CTD_human_DG	18333967		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	BEFREE	31564953		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy, Cryptogenic	Epilepsy	CTD_human_DG	18333967		★☆☆☆☆ Found in Text Mining only
Familial dilated cardiomyopathy	Cardiomyopathy	BEFREE	18451336, 23743182		★☆☆☆☆ Found in Text Mining only
familial dilated cardiomyopathy	Dilated cardiomyopathy	Pubtator	18451336	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31008529		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31008529		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	18451336	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30282322		★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	31539380		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30882592		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	31862408	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	34440356	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	12116189, 19181679, 24530440, 26630954		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	GWASDB_DG	21642993		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22377736		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	31539380		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	12116189, 15229186, 19181679, 20351719		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	12116189, 15229186, 19181679, 20351719		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	15229186		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	16000316		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	16000316		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopia	Myopia	BEFREE	23649821		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	31776299	Associate	★☆☆☆☆ Found in Text Mining only
Neurogenic Urinary Bladder	Neurogenic Urinary Bladder	LHGDN	14751843		★☆☆☆☆ Found in Text Mining only
Neurogenic Urinary Bladder	Neurogenic Urinary Bladder	CTD_human_DG	20624991		★☆☆☆☆ Found in Text Mining only
Neurogenic Urinary Bladder, Uninhibited	Neurogenic Urinary Bladder	CTD_human_DG	20624991		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	25155933, 27068006		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	25155933	Associate	★☆☆☆☆ Found in Text Mining only
Recurrent major depressive episodes	Mental Depression	BEFREE	19181679		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	20691427		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	27923235, 30623717		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22377736		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22377736	Associate	★☆☆☆☆ Found in Text Mining only
Symmetric Diabetic Proximal Motor Neuropathy	Symmetric Diabetic Proximal Motor Neuropathy	CTD_human_DG	20624991		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	12116189, 24530440		★☆☆☆☆ Found in Text Mining only