Gene Gene information from NCBI Gene database.
Entrez ID 11285
Gene name Beta-1,4-galactosyltransferase 7
Gene symbol B4GALT7
Synonyms (NCBI Gene)
EDSP1EDSSLAEDSSPD1XGALT1XGPTXGPT1
Chromosome 5
Chromosome location 5q35.3
Summary This gene is a member of the beta-1,4-galactosyltransferase (beta4GalT) family. Family members encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose. Each beta4GalT member has a distinc
SNPs SNP information provided by dbSNP.
10
SNP ID Visualize variation Clinical significance Consequence
rs28937869 C>T Pathogenic, likely-pathogenic Coding sequence variant, missense variant
rs121917817 C>A Pathogenic Coding sequence variant, missense variant
rs121917818 T>C Pathogenic Coding sequence variant, missense variant
rs142476892 C>G,T Conflicting-interpretations-of-pathogenicity, uncertain-significance Missense variant, coding sequence variant, 5 prime UTR variant
rs187063864 C>T Likely-pathogenic, pathogenic Missense variant, coding sequence variant, 5 prime UTR variant
miRNA miRNA information provided by mirtarbase database.
222
miRTarBase ID miRNA Experiments Reference
MIRT036015 hsa-miR-1301-3p CLASH 23622248
MIRT697141 hsa-miR-1910-3p HITS-CLIP 23313552
MIRT697140 hsa-miR-6511a-5p HITS-CLIP 23313552
MIRT682062 hsa-miR-4257 HITS-CLIP 23313552
MIRT682061 hsa-miR-1247-3p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
34
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0000139 Component Golgi membrane TAS
GO:0003831 Function Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase activity IDA 24052259
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005794 Component Golgi apparatus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604327 930 ENSG00000027847
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UBV7
Protein name Beta-1,4-galactosyltransferase 7 (Beta-1,4-GalTase 7) (Beta4Gal-T7) (b4Gal-T7) (EC 2.4.1.-) (Proteoglycan UDP-galactose:beta-xylose beta1,4-galactosyltransferase I) (UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 7) (UDP-galactose:beta-N-acetylglucosa
Protein function Required for the biosynthesis of the tetrasaccharide linkage region of proteoglycans, especially for small proteoglycans in skin fibroblasts.
PDB 4IRP , 4IRQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13733 Glyco_transf_7N 79 177 N-terminal region of glycosyl transferase group 7 Domain
PF02709 Glyco_transf_7C 181 259 N-terminal domain of galactosyltransferase Family
Tissue specificity TISSUE SPECIFICITY: High expression in heart, pancreas and liver, medium in placenta and kidney, low in brain, skeletal muscle and lung.
Sequence
MFPSRRKAAQLPWEDGRSGLLSGGLPRKCSVFHLFVACLSLGFFSLLWLQLSCSGDVARA
VRGQGQETSGPPRACPPEPPPEHWEEDASWGPHRLAVLVPFRERFEELLVFVPHMRRFLS
RKKIRHHIYVLNQVDHFRFNRAALINVGFLESSNSTDYIAMHDVDLLPLNEELDYGF
PEA
GPFHVASPELHPLYHYKTYVGGILLLSKQHYRLCNGMSNRFWGWGREDDEFYRRIKGAGL
QLFRPSGITTGYKTFRHLH
DPAWRKRDQKRIAAQKQEQFKVDREGGLNTVKYHVASRTAL
SVGGAPCTVLNIMLDCDKTATPWCTFS
Sequence length 327
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
Glycosaminoglycan biosynthesis - heparan sulfate / heparin
Metabolic pathways
  A tetrasaccharide linker sequence is required for GAG synthesis
Defective B4GALT7 causes EDS, progeroid type
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
26
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Ehlers-Danlos syndrome progeroid type Likely pathogenic; Pathogenic rs121917817, rs121917818, rs28937869, rs375845310, rs187063864 RCV000005963
RCV000005964
RCV000005965
RCV000210975
RCV000239499
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Ehlers-Danlos syndrome, spondylodysplastic type, 1 Pathogenic; Likely pathogenic rs28937869, rs187063864 RCV002482832
RCV003137853
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Larsen-like syndrome, B3GAT3 type Pathogenic rs28937869 RCV000258718
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Lethal skeletal dysplasia Pathogenic rs28937869 RCV000779599
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
B4GALT7-related disorder Likely benign; Uncertain significance; Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BONE FRAGILITY WITH CONTRACTURES, ARTERIAL RUPTURE, AND DEAFNESS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acquired Kyphoscoliosis Acquired Kyphoscoliosis HPO_DG
★☆☆☆☆
Found in Text Mining only
Aortic Valve Stenosis Aortic Valve Sclerosis HPO_DG
★☆☆☆☆
Found in Text Mining only
Arachnodactyly Arachnodactyly HPO_DG
★☆☆☆☆
Found in Text Mining only
B4GALT7-related spondylodysplastic Ehlers-Danlos syndrome Spondylodysplastic Ehlers-Danlos Syndrome Orphanet
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 38025683 Associate
★☆☆☆☆
Found in Text Mining only
Cockayne Syndrome Cockayne Syndrome BEFREE 15859521
★☆☆☆☆
Found in Text Mining only
Colitis Colitis BEFREE 24339869
★☆☆☆☆
Found in Text Mining only
Congenital disorder of glycosylation type 2D Congenital disorder of glycosylation BEFREE 11901181
★☆☆☆☆
Found in Text Mining only
Congenital Epicanthus Congenital Epicanthus HPO_DG
★☆☆☆☆
Found in Text Mining only
Congenital hypoplasia of clavicle Short clavicles HPO_DG
★☆☆☆☆
Found in Text Mining only