Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	11273
Gene name	Ataxin 2 like
Gene symbol	ATXN2L
Synonyms (NCBI Gene)	A2DA2LGA2LPA2RP
Chromosome	16
Chromosome location	16p11.2
Summary	This gene encodes an ataxin type 2 related protein of unknown function. This protein is a member of the spinocerebellar ataxia (SCAs) family, which is associated with a complex group of neurodegenerative disorders. Several alternatively spliced transcript

159

Show/Hide all (159)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023136	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT025212	hsa-miR-34a-5p	Proteomics	21566225
MIRT025212	hsa-miR-34a-5p	Proteomics	21566225
MIRT025212	hsa-miR-34a-5p	Proteomics	21566225
MIRT025212	hsa-miR-34a-5p	Proteomics	21566225
MIRT030105	hsa-miR-26b-5p	Microarray	19088304
MIRT031977	hsa-miR-16-5p	Proteomics	18668040
MIRT052632	hsa-let-7a-5p	CLASH	23622248
MIRT051974	hsa-let-7b-5p	CLASH	23622248
MIRT051974	hsa-let-7b-5p	CLASH	23622248
MIRT051554	hsa-let-7e-5p	CLASH	23622248
MIRT051389	hsa-let-7f-5p	CLASH	23622248
MIRT031977	hsa-miR-16-5p	CLASH	23622248
MIRT049467	hsa-miR-92a-3p	CLASH	23622248
MIRT043652	hsa-miR-326	CLASH	23622248
MIRT043087	hsa-miR-324-5p	CLASH	23622248
MIRT042988	hsa-miR-324-3p	CLASH	23622248
MIRT040952	hsa-miR-18a-3p	CLASH	23622248
MIRT039381	hsa-miR-421	CLASH	23622248
MIRT037491	hsa-miR-744-5p	CLASH	23622248
MIRT037491	hsa-miR-744-5p	CLASH	23622248
MIRT037491	hsa-miR-744-5p	CLASH	23622248
MIRT036758	hsa-miR-760	CLASH	23622248
MIRT036019	hsa-miR-1301-3p	CLASH	23622248
MIRT195017	hsa-miR-5692a	PAR-CLIP	21572407
MIRT544705	hsa-miR-3156-5p	PAR-CLIP	21572407
MIRT544704	hsa-miR-7161-3p	PAR-CLIP	21572407
MIRT544703	hsa-miR-141-5p	PAR-CLIP	21572407
MIRT544702	hsa-miR-3691-3p	PAR-CLIP	21572407
MIRT195016	hsa-miR-4670-3p	PAR-CLIP	21572407
MIRT195013	hsa-miR-340-5p	PAR-CLIP	21572407
MIRT195017	hsa-miR-5692a	PAR-CLIP	21572407
MIRT544705	hsa-miR-3156-5p	PAR-CLIP	21572407
MIRT544704	hsa-miR-7161-3p	PAR-CLIP	21572407
MIRT544703	hsa-miR-141-5p	PAR-CLIP	21572407
MIRT544702	hsa-miR-3691-3p	PAR-CLIP	21572407
MIRT195016	hsa-miR-4670-3p	PAR-CLIP	21572407
MIRT195013	hsa-miR-340-5p	PAR-CLIP	21572407
MIRT811105	hsa-miR-1233	CLIP-seq
MIRT811106	hsa-miR-1302	CLIP-seq
MIRT811107	hsa-miR-146b-3p	CLIP-seq
MIRT811108	hsa-miR-3173-5p	CLIP-seq
MIRT811109	hsa-miR-3607-5p	CLIP-seq
MIRT811110	hsa-miR-3665	CLIP-seq
MIRT811111	hsa-miR-4298	CLIP-seq
MIRT811112	hsa-miR-4648	CLIP-seq
MIRT811113	hsa-miR-4654	CLIP-seq
MIRT811114	hsa-miR-4687-5p	CLIP-seq
MIRT811115	hsa-miR-4767	CLIP-seq
MIRT811116	hsa-miR-4769-5p	CLIP-seq
MIRT811117	hsa-miR-552	CLIP-seq
MIRT811118	hsa-miR-657	CLIP-seq
MIRT811119	hsa-miR-764	CLIP-seq
MIRT811120	hsa-miR-3133	CLIP-seq
MIRT811121	hsa-miR-3136-3p	CLIP-seq
MIRT811122	hsa-miR-3153	CLIP-seq
MIRT811123	hsa-miR-377	CLIP-seq
MIRT811124	hsa-miR-4506	CLIP-seq
MIRT811125	hsa-miR-4668-5p	CLIP-seq
MIRT811126	hsa-miR-4773	CLIP-seq
MIRT811127	hsa-miR-569	CLIP-seq
MIRT811128	hsa-miR-668	CLIP-seq
MIRT1939919	hsa-miR-1236	CLIP-seq
MIRT1939920	hsa-miR-1275	CLIP-seq
MIRT1939921	hsa-miR-1293	CLIP-seq
MIRT1939922	hsa-miR-1294	CLIP-seq
MIRT1939923	hsa-miR-2392	CLIP-seq
MIRT1939924	hsa-miR-31	CLIP-seq
MIRT811120	hsa-miR-3133	CLIP-seq
MIRT811121	hsa-miR-3136-3p	CLIP-seq
MIRT1939925	hsa-miR-3144-5p	CLIP-seq
MIRT811122	hsa-miR-3153	CLIP-seq
MIRT1939926	hsa-miR-3191	CLIP-seq
MIRT1939927	hsa-miR-3192	CLIP-seq
MIRT1939928	hsa-miR-340	CLIP-seq
MIRT1939929	hsa-miR-3545-5p	CLIP-seq
MIRT1939930	hsa-miR-3605-5p	CLIP-seq
MIRT1939931	hsa-miR-3616-3p	CLIP-seq
MIRT1939932	hsa-miR-3689a-3p	CLIP-seq
MIRT1939933	hsa-miR-3689c	CLIP-seq
MIRT1939934	hsa-miR-376c	CLIP-seq
MIRT1939935	hsa-miR-3925-3p	CLIP-seq
MIRT1939936	hsa-miR-4271	CLIP-seq
MIRT1939937	hsa-miR-4316	CLIP-seq
MIRT1939938	hsa-miR-4463	CLIP-seq
MIRT1939939	hsa-miR-4483	CLIP-seq
MIRT1939940	hsa-miR-4492	CLIP-seq
MIRT1939941	hsa-miR-4498	CLIP-seq
MIRT1939942	hsa-miR-4505	CLIP-seq
MIRT811124	hsa-miR-4506	CLIP-seq
MIRT1939943	hsa-miR-4525	CLIP-seq
MIRT1939944	hsa-miR-4639-3p	CLIP-seq
MIRT1939945	hsa-miR-4652-5p	CLIP-seq
MIRT1939946	hsa-miR-4665-5p	CLIP-seq
MIRT811125	hsa-miR-4668-5p	CLIP-seq
MIRT1939947	hsa-miR-4696	CLIP-seq
MIRT1939948	hsa-miR-4712-3p	CLIP-seq
MIRT1939949	hsa-miR-4723-5p	CLIP-seq
MIRT1939950	hsa-miR-4725-3p	CLIP-seq
MIRT1939951	hsa-miR-4728-5p	CLIP-seq
MIRT1939952	hsa-miR-4731-5p	CLIP-seq
MIRT1939953	hsa-miR-4738-5p	CLIP-seq
MIRT811126	hsa-miR-4773	CLIP-seq
MIRT1939954	hsa-miR-4781-5p	CLIP-seq
MIRT1939955	hsa-miR-491-5p	CLIP-seq
MIRT1939956	hsa-miR-548n	CLIP-seq
MIRT1939957	hsa-miR-558	CLIP-seq
MIRT811127	hsa-miR-569	CLIP-seq
MIRT1939958	hsa-miR-615-3p	CLIP-seq
MIRT1939959	hsa-miR-625	CLIP-seq
MIRT1939960	hsa-miR-637	CLIP-seq
MIRT811128	hsa-miR-668	CLIP-seq
MIRT1939961	hsa-miR-762	CLIP-seq
MIRT1939962	hsa-miR-766	CLIP-seq
MIRT2179024	hsa-miR-1207-5p	CLIP-seq
MIRT1939921	hsa-miR-1293	CLIP-seq
MIRT1939922	hsa-miR-1294	CLIP-seq
MIRT2179025	hsa-miR-18a	CLIP-seq
MIRT2179026	hsa-miR-18b	CLIP-seq
MIRT1939923	hsa-miR-2392	CLIP-seq
MIRT1939924	hsa-miR-31	CLIP-seq
MIRT2179027	hsa-miR-3120-5p	CLIP-seq
MIRT811120	hsa-miR-3133	CLIP-seq
MIRT811121	hsa-miR-3136-3p	CLIP-seq
MIRT1939925	hsa-miR-3144-5p	CLIP-seq
MIRT811122	hsa-miR-3153	CLIP-seq
MIRT1939926	hsa-miR-3191	CLIP-seq
MIRT2179028	hsa-miR-342-3p	CLIP-seq
MIRT1939930	hsa-miR-3605-5p	CLIP-seq
MIRT1939931	hsa-miR-3616-3p	CLIP-seq
MIRT1939932	hsa-miR-3689a-3p	CLIP-seq
MIRT1939933	hsa-miR-3689c	CLIP-seq
MIRT811123	hsa-miR-377	CLIP-seq
MIRT1939935	hsa-miR-3925-3p	CLIP-seq
MIRT1939937	hsa-miR-4316	CLIP-seq
MIRT1939938	hsa-miR-4463	CLIP-seq
MIRT1939939	hsa-miR-4483	CLIP-seq
MIRT811124	hsa-miR-4506	CLIP-seq
MIRT1939945	hsa-miR-4652-5p	CLIP-seq
MIRT811125	hsa-miR-4668-5p	CLIP-seq
MIRT1939947	hsa-miR-4696	CLIP-seq
MIRT1939948	hsa-miR-4712-3p	CLIP-seq
MIRT1939951	hsa-miR-4728-5p	CLIP-seq
MIRT2179029	hsa-miR-4735-3p	CLIP-seq
MIRT2179030	hsa-miR-4736	CLIP-seq
MIRT1939953	hsa-miR-4738-5p	CLIP-seq
MIRT2179031	hsa-miR-4761-5p	CLIP-seq
MIRT2179032	hsa-miR-4763-3p	CLIP-seq
MIRT811126	hsa-miR-4773	CLIP-seq
MIRT1939954	hsa-miR-4781-5p	CLIP-seq
MIRT2179033	hsa-miR-486-3p	CLIP-seq
MIRT1939955	hsa-miR-491-5p	CLIP-seq
MIRT811127	hsa-miR-569	CLIP-seq
MIRT2179034	hsa-miR-593	CLIP-seq
MIRT1939959	hsa-miR-625	CLIP-seq
MIRT2179035	hsa-miR-636	CLIP-seq
MIRT811128	hsa-miR-668	CLIP-seq
MIRT1939962	hsa-miR-766	CLIP-seq
MIRT2179031	hsa-miR-4761-5p	CLIP-seq

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IBA
GO:0005515	Function	Protein binding	IPI	11784712, 19615732, 23209657, 24981860, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0010494	Component	Cytoplasmic stress granule	IBA
GO:0010494	Component	Cytoplasmic stress granule	IDA	23209657
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IDA	11784712
GO:0016020	Component	Membrane	IEA
GO:0016071	Process	MRNA metabolic process	IMP	23209657
GO:0016607	Component	Nuclear speck	IDA	23209657
GO:0016607	Component	Nuclear speck	IEA
GO:0034063	Process	Stress granule assembly	IBA
GO:0045296	Function	Cadherin binding	HDA	25468996

MIM	HGNC	e!Ensembl
607931	31326	ENSG00000168488

Q8WWM7

Protein name

Ataxin-2-like protein (Ataxin-2 domain protein) (Ataxin-2-related protein)

Protein function

Involved in the regulation of stress granule and P-body formation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14438	SM-ATX	120 → 196	Ataxin 2 SM domain	Domain
PF06741	LsmAD	264 → 332	LsmAD domain	Domain
PF07145	PAM2	654 → 669	Ataxin-2 C-terminal region	Motif

Tissue specificity

TISSUE SPECIFICITY: Expressed at high levels in thymus, lymph node, spleen, fetal kidney and adult testis. Constitutively associated with MPL and EPOR in hematopoietic cells. {ECO:0000269|PubMed:11784712}.

Sequence

MLKPQPLQQPSQPQQPPPTQQAVARRPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLG
PVAAAGSGLRRGAEGILAPQPPPPQQHQERPGAAAIGSARGQSTGKGPPQSPVFEGVYNN
SRMLHFLTAVVGSTCDVKVKNGTTYEGIFKTLSSKFELAVDAVHRKASEPAGGPRREDIV
DTMVFKPSDVMLVHFRNVDFNYATKDKFTDSAIAMNSKVNGEHKEKVLQRWEGGDSNSDD
YDLESDMSNGWDPNEMFKFNEENYGVKTTYDSSLSSYTVPLEKDNSEEFRQRELRAAQLA
REIESSPQYRLRIAMENDDGRTEEEKHSAVQRQGSGRESPSLASREGKYIPLPQRVREGP
RGGVRCSSSRGGRPGLSSLPPRGPHHLDNSSPGPGSEARGINGGPSRMSPKAQRPLRGAK
TLSSPSNRPSGETSVPPPPAVGRMYPPRSPKSAAPAPISASCPEPPIGSAVPTSSASIPV
TSSVSDPGVGSISPASPKISLAPTDVKELSTKEPGRTLEPQELARIAGKVPGLQNEQKRF
QLEELRKFGAQFKLQPSSSPENSLDPFPPRILKEEPKGKEKEVDGLLTSEPMGSPVSSKT
ESVSDKEDKPPLAPSGGTEGPEQPPPPCPSQTGSPPVGLIKGEDKDEGPVAEQVKKSTLN
PNAKEFNPTKPLLSVNKSTSTPTSPGPRTHSTPSIPVLTAGQSGLYSPQYISYIPQIHMG
PAVQAPQMYPYPVSNSVPGQQGKYRGAKGSLPPQRSDQHQPASAPPMMQAAAAAGPPLVA
ATPYSSYIPYNPQQFPGQPAMMQPMAHYPSQPVFAPMLQSNPRMLTSGSHPQAIVSSSTP
QYPSAEQPTPQALYATVHQSYPHHATQLHAHQPQPATTPTGSQPQSQHAAPSPVQHQAGQ
APHLGSGQPQQNLYHPGALTGTPPSLPPGPSAQSPQSSFPQPAAVYAIHHQQLPHGFTNM
AHVTQAHVQTGITAAPPPHPGAPHPPQVMLLHPPQSHGGPPQGAVPQSGVPALSASTPSP
YPYIGHPQGEQPGQAPGFPGGADDRIREFSLAGGIWHGRAEGLQVGQDARVLGGE

Sequence length

1075

Interactions

View interactions

	KEGG
	Amyotrophic lateral sclerosis Spinocerebellar ataxia Pathways of neurodegeneration - multiple diseases

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (26)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON VARIABLE IMMUNODEFICIENCY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGONADISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Marfanoid habitus and intellectual disability	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (31)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	33776902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26301688		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 1	Autoimmune Diseases	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 2	Autoimmune Diseases	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	GWASCAT_DG	26301688		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Common Variable Immunodeficiency	Common Variable Immunodeficiency	GWASCAT_DG	26301688		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	8462177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	8462177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	8231838, 8462177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoalphalipoproteinemia, Familial	Hypoalphalipoproteinemia	BEFREE	8231838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASDB_DG	19915574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	19915574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	19915574	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30787271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30787271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	37515398	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	22190364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26449484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	GWASCAT_DG	26301688		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spinocerebellar Ataxias	Spinocerebellar ataxia	Pubtator	11784712	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30787271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30787271	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	29262599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	34315405	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26301688		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

ATXN2L (ataxin 2 like)