Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	112616
Gene name	CKLF like MARVEL transmembrane domain containing 7
Gene symbol	CMTM7
Synonyms (NCBI Gene)	CKLFSF7
Chromosome	3
Chromosome location	3p22.3
Summary	This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene act

Show/Hide all (43)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022306	hsa-miR-124-3p	Microarray	18668037
MIRT899196	hsa-miR-1271	CLIP-seq
MIRT899197	hsa-miR-182	CLIP-seq
MIRT899198	hsa-miR-3660	CLIP-seq
MIRT899199	hsa-miR-4293	CLIP-seq
MIRT899200	hsa-miR-4526	CLIP-seq
MIRT899201	hsa-miR-4700-3p	CLIP-seq
MIRT899202	hsa-miR-873	CLIP-seq
MIRT899203	hsa-miR-96	CLIP-seq
MIRT899204	hsa-miR-139-5p	CLIP-seq
MIRT899205	hsa-miR-3622a-5p	CLIP-seq
MIRT899206	hsa-miR-3667-5p	CLIP-seq
MIRT899207	hsa-miR-3675-3p	CLIP-seq
MIRT899208	hsa-miR-4255	CLIP-seq
MIRT899209	hsa-miR-4269	CLIP-seq
MIRT899210	hsa-miR-4438	CLIP-seq
MIRT899211	hsa-miR-5095	CLIP-seq
MIRT899212	hsa-miR-583	CLIP-seq
MIRT899202	hsa-miR-873	CLIP-seq
MIRT2202494	hsa-miR-1343	CLIP-seq
MIRT2202495	hsa-miR-2278	CLIP-seq
MIRT2202496	hsa-miR-3124-3p	CLIP-seq
MIRT2202497	hsa-miR-3170	CLIP-seq
MIRT2202498	hsa-miR-3192	CLIP-seq
MIRT2202499	hsa-miR-3714	CLIP-seq
MIRT2202500	hsa-miR-4476	CLIP-seq
MIRT2202501	hsa-miR-4487	CLIP-seq
MIRT2202502	hsa-miR-4777-5p	CLIP-seq
MIRT2202503	hsa-miR-516a-3p	CLIP-seq
MIRT2202504	hsa-miR-518d-5p	CLIP-seq
MIRT2202505	hsa-miR-519b-5p	CLIP-seq
MIRT2202506	hsa-miR-519c-5p	CLIP-seq
MIRT2202507	hsa-miR-520c-5p	CLIP-seq
MIRT2202508	hsa-miR-526a	CLIP-seq
MIRT2202509	hsa-miR-544b	CLIP-seq
MIRT2202510	hsa-miR-570	CLIP-seq
MIRT2202511	hsa-miR-876-3p	CLIP-seq
MIRT2202496	hsa-miR-3124-3p	CLIP-seq
MIRT2447285	hsa-miR-3160-5p	CLIP-seq
MIRT2447286	hsa-miR-3612	CLIP-seq
MIRT2447287	hsa-miR-4443	CLIP-seq
MIRT2447288	hsa-miR-485-5p	CLIP-seq
MIRT2447289	hsa-miR-650	CLIP-seq

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002337	Process	B-1a B cell differentiation	IEA
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005615	Component	Extracellular space	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA

MIM	HGNC	e!Ensembl
607890	19178	ENSG00000153551

Q96FZ5

Protein name

CKLF-like MARVEL transmembrane domain-containing protein 7 (Chemokine-like factor superfamily member 7)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01284	MARVEL	40 → 160	Membrane-associating domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in leukocytes. {ECO:0000269|PubMed:12782130}.

Sequence

MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTHAALLKVAQMVTLLIAF
ICVRSSLWTNYSAYSYFEVVTICDLIMILAFYLVHLFRFYRVLTCISWPLSELLHYLIGT
LLLLIASIVAASKSYNQSGLVAGAIFGFMATFLCMASIWLSYKISCVTQSTDAAV

Sequence length

175

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	32568178, 35575054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36829181	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30903681	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36975415	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30903681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	GWASDB_DG	20400778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	GWASCAT_DG	20400778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30903681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30392914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23893243, 23981602, 30392914, 30903681, 31846072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23981602, 26528697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	32111069	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31081901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30392914		★★★★★ ★☆☆☆☆ Found in Text Mining only

CMTM7 (CKLF like MARVEL transmembrane domain containing 7)