HRH3 (histamine receptor H3)

Gene

• Entrez ID: 11255
• Gene name: Histamine receptor H3
• Gene symbol: HRH3
• Synonyms (NCBI Gene): GPCR97, HH3R
• Chromosome: 20
• Chromosome location: 20q13.33
• Summary: Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by histamine receptors H1, H2, H3 and H4. This gene encodes one of the histamine receptors (H3) which belongs

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT756048	hsa-miR-4696	Microarray, qRT-PCR	35899934
MIRT756049	hsa-miR-1275	Microarray, qRT-PCR	35899934
MIRT1054689	hsa-miR-1207-5p	CLIP-seq
MIRT1054690	hsa-miR-2682	CLIP-seq
MIRT1054691	hsa-miR-3151	CLIP-seq
MIRT1054692	hsa-miR-34a	CLIP-seq
MIRT1054693	hsa-miR-34c-5p	CLIP-seq
MIRT1054694	hsa-miR-3714	CLIP-seq
MIRT1054695	hsa-miR-3918	CLIP-seq
MIRT1054696	hsa-miR-4447	CLIP-seq
MIRT1054697	hsa-miR-4472	CLIP-seq
MIRT1054698	hsa-miR-449a	CLIP-seq
MIRT1054699	hsa-miR-449b	CLIP-seq
MIRT1054700	hsa-miR-449c	CLIP-seq
MIRT1054701	hsa-miR-4763-3p	CLIP-seq
MIRT1054702	hsa-miR-486-3p	CLIP-seq
MIRT1054703	hsa-miR-491-5p	CLIP-seq
MIRT1054704	hsa-miR-545	CLIP-seq
MIRT1054705	hsa-miR-548an	CLIP-seq
MIRT2244734	hsa-miR-3925-3p	CLIP-seq
MIRT2244735	hsa-miR-455-3p	CLIP-seq
MIRT2451380	hsa-miR-1302	CLIP-seq
MIRT2451381	hsa-miR-3122	CLIP-seq
MIRT2451382	hsa-miR-3181	CLIP-seq
MIRT2451383	hsa-miR-3189-3p	CLIP-seq
MIRT2451384	hsa-miR-3649	CLIP-seq
MIRT2451385	hsa-miR-3913-5p	CLIP-seq
MIRT2451386	hsa-miR-4298	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004969	Function	Histamine receptor activity	IBA
GO:0004969	Function	Histamine receptor activity	IEA
GO:0004969	Function	Histamine receptor activity	TAS	10347254
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10347254
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	10347254
GO:0007197	Process	Adenylate cyclase-inhibiting G protein-coupled acetylcholine receptor signaling pathway	IBA
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0007269	Process	Neurotransmitter secretion	TAS	10347254
GO:0016020	Component	Membrane	IEA
GO:0030425	Component	Dendrite	IBA
GO:0030594	Function	Neurotransmitter receptor activity	IBA
GO:0045202	Component	Synapse	IBA
GO:0098793	Component	Presynapse	IEA

Other IDs

• MIM: 604525
• HGNC: 5184
• e!Ensembl: ENSG00000101180

Protein

• UniProt ID: Q9Y5N1
• Protein name: Histamine H3 receptor (H3R) (HH3R) (G-protein coupled receptor 97)
• Protein function: The H3 subclass of histamine receptors could mediate the histamine signals in CNS and peripheral nervous system. Signals through the inhibition of adenylate cyclase and displays high constitutive activity (spontaneous activity in the absence of
• PDB: 7F61, 8YN5, 8YN6, 8YN7, 8YN8, 8YUU, 8YUV
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	51 → 412	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed predominantly in the CNS, with the greatest expression in the thalamus and caudate nucleus. The various isoforms are mainly coexpressed in brain, but their relative expression level varies in a region-specific manner. Isoform
• Sequence:

  MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
  ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTS
  SAFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGG
  SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGAREAA
  GPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSV
  ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKSL
  AVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHHSFR
  RAFTKLLCPQKLKIQPHSSLEHCWK

• Sequence length: 445

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Reactome:

Histamine receptors
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMNESIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMNESTIC DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Age-Related Memory Disorders	Age-Related Memory Disorders	CTD_human_DG	16488453		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	19568768		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	29701013	Associate	★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	CTD_human_DG	11125734		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amnesia	Amnesia	BEFREE	30863075		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anaphylaxis	Anaphylaxis	Pubtator	28465562	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	28969474	Associate	★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	19568768		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	28863002		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	35877665	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	23894272		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24835231		★☆☆☆☆ Found in Text Mining only
Cataplexy	Cataplexy	BEFREE	28129985, 31838740		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	19825989		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	17129577, 19222483		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28863002, 30801695		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	37329185	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36902343	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	26989676		★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	31718622	Associate	★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	28465562	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	26989676	Associate	★☆☆☆☆ Found in Text Mining only
Hypersomnia	Hypersomnia	BEFREE	30957954		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	CTD_human_DG	9050021		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Impaired cognition	Impaired Cognition	BEFREE	16316645, 28863002, 31724859		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31002350		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	33159174	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24835231		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31002350		★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory Disorders	CTD_human_DG	16488453		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	28863002		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	21376262		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29253893		★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	BEFREE	18295497, 28129985, 30771351, 31838740		★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	Pubtator	29701013	Associate	★☆☆☆☆ Found in Text Mining only
Narcolepsy type 1	Narcolepsy	BEFREE	31632459		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	31740666		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16316645, 23591110, 23591112		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35751684	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	11493035, 28398338		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	38159685	Associate	★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	28398338		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	31740666		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	37329185	Associate	★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	27855565		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	21652606		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	29701013, 37329185, 38159685	Associate	★☆☆☆☆ Found in Text Mining only
Shy-Drager Syndrome	Shy-Drager Syndrome	BEFREE	11956964		★☆☆☆☆ Found in Text Mining only
Shy-Drager Syndrome	Shy-Drager Syndrome	LHGDN	11956964		★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	15530639, 30957954		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	31739417		★☆☆☆☆ Found in Text Mining only
Tic disorder	Tic Disorder	BEFREE	28117842		★☆☆☆☆ Found in Text Mining only