GTF3C6 (general transcription factor IIIC subunit 6)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 112495
Gene name General transcription factor IIIC subunit 6
Gene symbol GTF3C6
Synonyms (NCBI Gene)
C6orf51TFIIIC35bA397G5.3
Chromosome 6
Chromosome location 6q21
Summary RNA polymerases are unable to initiate RNA synthesis in the absence of additional proteins called general transcription factors (GTFs). GTFs assemble in a complex on the DNA promoter and recruit the RNA polymerase. GTF3C family proteins (e.g., GTF3C1, MIM
miRNA miRNA information provided by mirtarbase database.
71
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (71)
miRTarBase ID miRNA Experiments Reference
MIRT022263 hsa-miR-124-3p Microarray 18668037
MIRT023234 hsa-miR-122-5p Microarray 17612493
MIRT023623 hsa-miR-1-3p Proteomics;Microarray 18668037
MIRT681423 hsa-miR-6746-5p HITS-CLIP 23706177
MIRT681422 hsa-miR-4680-5p HITS-CLIP 23706177
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (15)
GO ID Ontology Definition Evidence Reference
GO:0000127 Component Transcription factor TFIIIC complex IBA
GO:0000127 Component Transcription factor TFIIIC complex IDA 17409385
GO:0000995 Function RNA polymerase III general transcription initiation factor activity IDA 17409385
GO:0003677 Function DNA binding IDA 17409385
GO:0003677 Function DNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
611784 20872 ENSG00000155115
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q969F1
Protein name General transcription factor 3C polypeptide 6 (Transcription factor IIIC 35 kDa subunit) (TFIIIC 35 kDa subunit) (TFIIIC35) (Transcription factor IIIC subunit 6)
Protein function Involved in RNA polymerase III-mediated transcription. Integral, tightly associated component of the DNA-binding TFIIIC2 subcomplex that directly binds tRNA and virus-associated RNA promoters.
PDB 8CLK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10419 TFIIIC_sub6 16 → 111 TFIIIC subunit triple barrel domain Domain
Sequence 
MAAAADERSPEDGEDEEEEEQLVLVELSGIIDSDFLSKCENKCKVLGIDTERPILQVDSC
VFAGEYEDTLGTCVIFEENVEHADTEGNNKTVLKYKCHTMKKLSMTRTLLTEKKEGEENI
GGVEWLQIKDNDFSYRPNMICNFLHENEDEEVVASAPDKSLELEEEEIQMNDSSNLSCEQ
EKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP
Sequence length 213
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    RNA Polymerase III Transcription Initiation From Type 1 Promoter
RNA Polymerase III Transcription Initiation From Type 2 Promoter
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
LYMPHOID LEUKEMIA — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations