Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	11247
Gene name	Neurexophilin 4
Gene symbol	NXPH4
Synonyms (NCBI Gene)	NPH4
Chromosome	12
Chromosome location	12q13.3

Show/Hide all (72)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030127	hsa-miR-26b-5p	Microarray	19088304
MIRT037557	hsa-miR-744-5p	CLASH	23622248
MIRT037557	hsa-miR-744-5p	CLASH	23622248
MIRT1200699	hsa-miR-1245b-5p	CLIP-seq
MIRT1200700	hsa-miR-1254	CLIP-seq
MIRT1200701	hsa-miR-1275	CLIP-seq
MIRT1200702	hsa-miR-1286	CLIP-seq
MIRT1200703	hsa-miR-1295	CLIP-seq
MIRT1200704	hsa-miR-15a	CLIP-seq
MIRT1200705	hsa-miR-15b	CLIP-seq
MIRT1200706	hsa-miR-16	CLIP-seq
MIRT1200707	hsa-miR-1908	CLIP-seq
MIRT1200708	hsa-miR-195	CLIP-seq
MIRT1200709	hsa-miR-214	CLIP-seq
MIRT1200710	hsa-miR-24	CLIP-seq
MIRT1200711	hsa-miR-2467-5p	CLIP-seq
MIRT1200712	hsa-miR-3064-5p	CLIP-seq
MIRT1200713	hsa-miR-3116	CLIP-seq
MIRT1200714	hsa-miR-3125	CLIP-seq
MIRT1200715	hsa-miR-3142	CLIP-seq
MIRT1200716	hsa-miR-3153	CLIP-seq
MIRT1200717	hsa-miR-3169	CLIP-seq
MIRT1200718	hsa-miR-3616-3p	CLIP-seq
MIRT1200719	hsa-miR-3619-5p	CLIP-seq
MIRT1200720	hsa-miR-3664-3p	CLIP-seq
MIRT1200721	hsa-miR-3665	CLIP-seq
MIRT1200722	hsa-miR-3689a-3p	CLIP-seq
MIRT1200723	hsa-miR-3689c	CLIP-seq
MIRT1200724	hsa-miR-3916	CLIP-seq
MIRT1200725	hsa-miR-424	CLIP-seq
MIRT1200726	hsa-miR-4436a	CLIP-seq
MIRT1200727	hsa-miR-4436b-3p	CLIP-seq
MIRT1200728	hsa-miR-4514	CLIP-seq
MIRT1200729	hsa-miR-4515	CLIP-seq
MIRT1200730	hsa-miR-4523	CLIP-seq
MIRT1200731	hsa-miR-4525	CLIP-seq
MIRT1200732	hsa-miR-4633-3p	CLIP-seq
MIRT1200733	hsa-miR-4665-5p	CLIP-seq
MIRT1200734	hsa-miR-4668-5p	CLIP-seq
MIRT1200735	hsa-miR-4692	CLIP-seq
MIRT1200736	hsa-miR-4722-5p	CLIP-seq
MIRT1200737	hsa-miR-4723-5p	CLIP-seq
MIRT1200738	hsa-miR-4728-5p	CLIP-seq
MIRT1200739	hsa-miR-4730	CLIP-seq
MIRT1200740	hsa-miR-4731-5p	CLIP-seq
MIRT1200741	hsa-miR-4736	CLIP-seq
MIRT1200742	hsa-miR-4768-3p	CLIP-seq
MIRT1200743	hsa-miR-4790-3p	CLIP-seq
MIRT1200744	hsa-miR-497	CLIP-seq
MIRT1200745	hsa-miR-518e	CLIP-seq
MIRT1200746	hsa-miR-541	CLIP-seq
MIRT1200747	hsa-miR-582-5p	CLIP-seq
MIRT1200748	hsa-miR-625	CLIP-seq
MIRT1200749	hsa-miR-637	CLIP-seq
MIRT1200750	hsa-miR-654-5p	CLIP-seq
MIRT1200751	hsa-miR-661	CLIP-seq
MIRT1200752	hsa-miR-663	CLIP-seq
MIRT1200753	hsa-miR-761	CLIP-seq
MIRT1200754	hsa-miR-892b	CLIP-seq
MIRT2286448	hsa-miR-1224-3p	CLIP-seq
MIRT2286449	hsa-miR-1260	CLIP-seq
MIRT2286450	hsa-miR-1260b	CLIP-seq
MIRT2286451	hsa-miR-1280	CLIP-seq
MIRT2286452	hsa-miR-141	CLIP-seq
MIRT2286453	hsa-miR-200a	CLIP-seq
MIRT2286454	hsa-miR-3179	CLIP-seq
MIRT2286455	hsa-miR-3202	CLIP-seq
MIRT2286456	hsa-miR-4646-5p	CLIP-seq
MIRT2286457	hsa-miR-4701-5p	CLIP-seq
MIRT2286458	hsa-miR-4747-5p	CLIP-seq
MIRT2286459	hsa-miR-588	CLIP-seq
MIRT2286460	hsa-miR-615-5p	CLIP-seq

Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0007218	Process	Neuropeptide signaling pathway	NAS	9570794
GO:0045202	Component	Synapse	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0098982	Component	GABA-ergic synapse	IEA

MIM	HGNC	e!Ensembl
604637	8078	ENSG00000182379

O95158

Protein name

Neurexophilin-4

Protein function

May be signaling molecules that resemble neuropeptides and that act by binding to alpha-neurexins and possibly other receptors.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06312	Neurexophilin	69 → 166	Neurexophilin	Family
PF06312	Neurexophilin	221 → 308	Neurexophilin	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain, spleen, and testis.

Sequence

MRLLPEWFLLLFGPWLLRKAVSAQIPESGRPQYLGLRPAAAGAGAPGQQLPEPRSSDGLG
VGRAWSWAWPTNHTGALARAGAAGALPAQRTKRKPSIKAARAKKIFGWGDFYFRVHTLKF
SLLVTGKIVDHVNGTFSVYFRHNSSSLGNLSVSIVPPSKRVEFGGVWLPGPVPHPLQSTL
ALEGVLPGLGPPLGMAAAAAGPGLGGSLGGALAGPLGGALGVPGAKESRAFNCHVEYEKT
NRARKHRPCLYDPSQVCFTEHTQSQAAWLCAKPFKVICIFVSFLSFDYKLVQKVCPDYNF
QSEHPYFG

Sequence length

308

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis, Gouty	Gouty arthritis	GWASDB_DG	23263486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal dominant compelling helio ophthalmic outburst syndrome	Achoo syndrome	GWASCAT_DG	27182965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	38613793	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASDB_DG	23263486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35462469, 35758021	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NXPH4 (neurexophilin 4)