Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	11240
Gene name	Peptidyl arginine deiminase 2
Gene symbol	PADI2
Synonyms (NCBI Gene)	PAD-H19PAD2PDI2
Chromosome	1
Chromosome location	1p36.13
Summary	This gene encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distin

254

Show/Hide all (254)

miRTarBase ID	miRNA	Experiments	Reference
MIRT655549	hsa-miR-5088-3p	HITS-CLIP	19536157
MIRT655548	hsa-miR-6734-3p	HITS-CLIP	19536157
MIRT655547	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT655544	hsa-miR-623	HITS-CLIP	19536157
MIRT655543	hsa-miR-204-5p	HITS-CLIP	19536157
MIRT655542	hsa-miR-211-5p	HITS-CLIP	19536157
MIRT655541	hsa-miR-4713-5p	HITS-CLIP	19536157
MIRT655540	hsa-miR-6867-3p	HITS-CLIP	19536157
MIRT655539	hsa-miR-4755-5p	HITS-CLIP	19536157
MIRT655537	hsa-miR-5006-3p	HITS-CLIP	19536157
MIRT655538	hsa-miR-629-3p	HITS-CLIP	19536157
MIRT655551	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT655550	hsa-miR-6795-3p	HITS-CLIP	23824327
MIRT655549	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT655548	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT655547	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT655546	hsa-miR-3128	HITS-CLIP	23824327
MIRT655545	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT655544	hsa-miR-623	HITS-CLIP	23824327
MIRT655543	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT655542	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT655541	hsa-miR-4713-5p	HITS-CLIP	23824327
MIRT655540	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT655539	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT655537	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT655538	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT625830	hsa-miR-8485	HITS-CLIP	23824327
MIRT625829	hsa-miR-4643	HITS-CLIP	23824327
MIRT625830	hsa-miR-8485	HITS-CLIP	23824327
MIRT625829	hsa-miR-4643	HITS-CLIP	23824327
MIRT498285	hsa-miR-4418	PAR-CLIP	22291592
MIRT498284	hsa-miR-509-3-5p	PAR-CLIP	22291592
MIRT498283	hsa-miR-509-5p	PAR-CLIP	22291592
MIRT498282	hsa-miR-3158-5p	PAR-CLIP	22291592
MIRT498281	hsa-miR-2467-3p	PAR-CLIP	22291592
MIRT498280	hsa-miR-3678-3p	PAR-CLIP	22291592
MIRT655549	hsa-miR-5088-3p	HITS-CLIP	19536157
MIRT655548	hsa-miR-6734-3p	HITS-CLIP	19536157
MIRT655547	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT655544	hsa-miR-623	HITS-CLIP	19536157
MIRT655543	hsa-miR-204-5p	HITS-CLIP	19536157
MIRT655542	hsa-miR-211-5p	HITS-CLIP	19536157
MIRT655541	hsa-miR-4713-5p	HITS-CLIP	19536157
MIRT655540	hsa-miR-6867-3p	HITS-CLIP	19536157
MIRT655539	hsa-miR-4755-5p	HITS-CLIP	19536157
MIRT655537	hsa-miR-5006-3p	HITS-CLIP	19536157
MIRT655538	hsa-miR-629-3p	HITS-CLIP	19536157
MIRT655551	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT655550	hsa-miR-6795-3p	HITS-CLIP	23824327
MIRT655549	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT655548	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT655547	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT655546	hsa-miR-3128	HITS-CLIP	23824327
MIRT655545	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT655544	hsa-miR-623	HITS-CLIP	23824327
MIRT655543	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT655542	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT655541	hsa-miR-4713-5p	HITS-CLIP	23824327
MIRT655540	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT655539	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT655537	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT655538	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT625830	hsa-miR-8485	HITS-CLIP	23824327
MIRT625829	hsa-miR-4643	HITS-CLIP	23824327
MIRT625830	hsa-miR-8485	HITS-CLIP	23824327
MIRT625829	hsa-miR-4643	HITS-CLIP	23824327
MIRT498285	hsa-miR-4418	PAR-CLIP	22291592
MIRT498284	hsa-miR-509-3-5p	PAR-CLIP	22291592
MIRT498283	hsa-miR-509-5p	PAR-CLIP	22291592
MIRT498282	hsa-miR-3158-5p	PAR-CLIP	22291592
MIRT498281	hsa-miR-2467-3p	PAR-CLIP	22291592
MIRT498280	hsa-miR-3678-3p	PAR-CLIP	22291592
MIRT1210193	hsa-miR-1276	CLIP-seq
MIRT1210194	hsa-miR-183	CLIP-seq
MIRT1210195	hsa-miR-3179	CLIP-seq
MIRT1210196	hsa-miR-3182	CLIP-seq
MIRT1210197	hsa-miR-374a	CLIP-seq
MIRT1210198	hsa-miR-374b	CLIP-seq
MIRT1210199	hsa-miR-4263	CLIP-seq
MIRT1210200	hsa-miR-4311	CLIP-seq
MIRT1210201	hsa-miR-4420	CLIP-seq
MIRT1210202	hsa-miR-4509	CLIP-seq
MIRT1210203	hsa-miR-4659a-3p	CLIP-seq
MIRT1210204	hsa-miR-4659b-3p	CLIP-seq
MIRT1210205	hsa-miR-4688	CLIP-seq
MIRT1210206	hsa-miR-4729	CLIP-seq
MIRT1210207	hsa-miR-4733-3p	CLIP-seq
MIRT1210208	hsa-miR-4744	CLIP-seq
MIRT1210209	hsa-miR-4760-3p	CLIP-seq
MIRT1210210	hsa-miR-4799-5p	CLIP-seq
MIRT1210211	hsa-miR-486-3p	CLIP-seq
MIRT1210212	hsa-miR-576-5p	CLIP-seq
MIRT1210213	hsa-miR-579	CLIP-seq
MIRT1210214	hsa-miR-583	CLIP-seq
MIRT1210215	hsa-miR-664	CLIP-seq
MIRT1210193	hsa-miR-1276	CLIP-seq
MIRT1210200	hsa-miR-4311	CLIP-seq
MIRT1210208	hsa-miR-4744	CLIP-seq
MIRT1210214	hsa-miR-583	CLIP-seq
MIRT2060261	hsa-miR-1182	CLIP-seq
MIRT2060262	hsa-miR-124	CLIP-seq
MIRT2060263	hsa-miR-1271	CLIP-seq
MIRT2060264	hsa-miR-135a	CLIP-seq
MIRT2060265	hsa-miR-135b	CLIP-seq
MIRT2060266	hsa-miR-182	CLIP-seq
MIRT2060267	hsa-miR-193a-5p	CLIP-seq
MIRT2060268	hsa-miR-2964a-5p	CLIP-seq
MIRT2060269	hsa-miR-3120-5p	CLIP-seq
MIRT2060270	hsa-miR-3123	CLIP-seq
MIRT2060271	hsa-miR-3130-3p	CLIP-seq
MIRT2060272	hsa-miR-3134	CLIP-seq
MIRT2060273	hsa-miR-3201	CLIP-seq
MIRT2060274	hsa-miR-346	CLIP-seq
MIRT2060275	hsa-miR-3919	CLIP-seq
MIRT2060276	hsa-miR-4270	CLIP-seq
MIRT2060277	hsa-miR-4288	CLIP-seq
MIRT2060278	hsa-miR-4299	CLIP-seq
MIRT2060279	hsa-miR-4426	CLIP-seq
MIRT2060280	hsa-miR-4441	CLIP-seq
MIRT2060281	hsa-miR-4470	CLIP-seq
MIRT2060282	hsa-miR-4502	CLIP-seq
MIRT2060283	hsa-miR-4647	CLIP-seq
MIRT2060284	hsa-miR-4662b	CLIP-seq
MIRT1210205	hsa-miR-4688	CLIP-seq
MIRT2060285	hsa-miR-4712-3p	CLIP-seq
MIRT2060286	hsa-miR-4791	CLIP-seq
MIRT2060287	hsa-miR-4793-3p	CLIP-seq
MIRT2060288	hsa-miR-506	CLIP-seq
MIRT2060289	hsa-miR-548an	CLIP-seq
MIRT2060290	hsa-miR-632	CLIP-seq
MIRT2060291	hsa-miR-9	CLIP-seq
MIRT2060292	hsa-miR-96	CLIP-seq
MIRT2060261	hsa-miR-1182	CLIP-seq
MIRT2288664	hsa-miR-1245b-5p	CLIP-seq
MIRT2288665	hsa-miR-1253	CLIP-seq
MIRT2288666	hsa-miR-1256	CLIP-seq
MIRT2288667	hsa-miR-1266	CLIP-seq
MIRT1210193	hsa-miR-1276	CLIP-seq
MIRT2288668	hsa-miR-1287	CLIP-seq
MIRT2288669	hsa-miR-1321	CLIP-seq
MIRT2288670	hsa-miR-1587	CLIP-seq
MIRT2288671	hsa-miR-185	CLIP-seq
MIRT2288672	hsa-miR-197	CLIP-seq
MIRT2288673	hsa-miR-203	CLIP-seq
MIRT738859	hsa-miR-214	CLIP-seq
MIRT2288674	hsa-miR-31	CLIP-seq
MIRT2060270	hsa-miR-3123	CLIP-seq
MIRT2288675	hsa-miR-3135b	CLIP-seq
MIRT2288676	hsa-miR-3142	CLIP-seq
MIRT2288677	hsa-miR-3147	CLIP-seq
MIRT2288678	hsa-miR-3150a-3p	CLIP-seq
MIRT2288679	hsa-miR-3164	CLIP-seq
MIRT2288680	hsa-miR-3173-3p	CLIP-seq
MIRT2288681	hsa-miR-3175	CLIP-seq
MIRT1210195	hsa-miR-3179	CLIP-seq
MIRT2288682	hsa-miR-3190	CLIP-seq
MIRT2288683	hsa-miR-326	CLIP-seq
MIRT2288684	hsa-miR-330-5p	CLIP-seq
MIRT2288685	hsa-miR-34a	CLIP-seq
MIRT2288686	hsa-miR-34c-5p	CLIP-seq
MIRT2288687	hsa-miR-3545-3p	CLIP-seq
MIRT2288688	hsa-miR-3612	CLIP-seq
MIRT738861	hsa-miR-3619-5p	CLIP-seq
MIRT2288689	hsa-miR-3652	CLIP-seq
MIRT2288690	hsa-miR-3664-3p	CLIP-seq
MIRT2288691	hsa-miR-3714	CLIP-seq
MIRT2060275	hsa-miR-3919	CLIP-seq
MIRT2288692	hsa-miR-3974	CLIP-seq
MIRT1210199	hsa-miR-4263	CLIP-seq
MIRT2060276	hsa-miR-4270	CLIP-seq
MIRT2288693	hsa-miR-4283	CLIP-seq
MIRT738863	hsa-miR-4291	CLIP-seq
MIRT2060278	hsa-miR-4299	CLIP-seq
MIRT2288694	hsa-miR-4306	CLIP-seq
MIRT1210200	hsa-miR-4311	CLIP-seq
MIRT1210201	hsa-miR-4420	CLIP-seq
MIRT2288695	hsa-miR-4425	CLIP-seq
MIRT2060279	hsa-miR-4426	CLIP-seq
MIRT2288696	hsa-miR-4430	CLIP-seq
MIRT2060280	hsa-miR-4441	CLIP-seq
MIRT2288697	hsa-miR-4457	CLIP-seq
MIRT2060281	hsa-miR-4470	CLIP-seq
MIRT2288698	hsa-miR-4476	CLIP-seq
MIRT2288699	hsa-miR-4489	CLIP-seq
MIRT2288700	hsa-miR-4492	CLIP-seq
MIRT2288701	hsa-miR-4498	CLIP-seq
MIRT2288702	hsa-miR-449a	CLIP-seq
MIRT2288703	hsa-miR-449b	CLIP-seq
MIRT2060282	hsa-miR-4502	CLIP-seq
MIRT1210202	hsa-miR-4509	CLIP-seq
MIRT2288704	hsa-miR-450b-5p	CLIP-seq
MIRT2288705	hsa-miR-4511	CLIP-seq
MIRT2288706	hsa-miR-4518	CLIP-seq
MIRT2288707	hsa-miR-4644	CLIP-seq
MIRT2288708	hsa-miR-4645-5p	CLIP-seq
MIRT2060283	hsa-miR-4647	CLIP-seq
MIRT2288709	hsa-miR-4656	CLIP-seq
MIRT2060284	hsa-miR-4662b	CLIP-seq
MIRT2288710	hsa-miR-4667-5p	CLIP-seq
MIRT2288711	hsa-miR-4673	CLIP-seq
MIRT2288712	hsa-miR-4674	CLIP-seq
MIRT2288713	hsa-miR-4675	CLIP-seq
MIRT2288714	hsa-miR-4680-5p	CLIP-seq
MIRT2288715	hsa-miR-4682	CLIP-seq
MIRT2288716	hsa-miR-4687-3p	CLIP-seq
MIRT1210205	hsa-miR-4688	CLIP-seq
MIRT2288717	hsa-miR-4695-5p	CLIP-seq
MIRT2288718	hsa-miR-4700-5p	CLIP-seq
MIRT2288719	hsa-miR-4709-5p	CLIP-seq
MIRT2288720	hsa-miR-4717-5p	CLIP-seq
MIRT2288721	hsa-miR-4720-5p	CLIP-seq
MIRT2288722	hsa-miR-4728-3p	CLIP-seq
MIRT1210206	hsa-miR-4729	CLIP-seq
MIRT2288723	hsa-miR-4739	CLIP-seq
MIRT2288724	hsa-miR-4741	CLIP-seq
MIRT2288725	hsa-miR-4742-5p	CLIP-seq
MIRT1210208	hsa-miR-4744	CLIP-seq
MIRT2288726	hsa-miR-4756-5p	CLIP-seq
MIRT2288727	hsa-miR-4757-5p	CLIP-seq
MIRT738858	hsa-miR-4797-5p	CLIP-seq
MIRT2288728	hsa-miR-4799-3p	CLIP-seq
MIRT1210210	hsa-miR-4799-5p	CLIP-seq
MIRT2288729	hsa-miR-485-5p	CLIP-seq
MIRT1210211	hsa-miR-486-3p	CLIP-seq
MIRT2288730	hsa-miR-493	CLIP-seq
MIRT2288731	hsa-miR-507	CLIP-seq
MIRT2288732	hsa-miR-5096	CLIP-seq
MIRT2288733	hsa-miR-513b	CLIP-seq
MIRT2060289	hsa-miR-548an	CLIP-seq
MIRT2288734	hsa-miR-548c-3p	CLIP-seq
MIRT2288735	hsa-miR-557	CLIP-seq
MIRT1210212	hsa-miR-576-5p	CLIP-seq
MIRT1210214	hsa-miR-583	CLIP-seq
MIRT2288736	hsa-miR-604	CLIP-seq
MIRT2288737	hsa-miR-630	CLIP-seq
MIRT2288738	hsa-miR-637	CLIP-seq
MIRT2288739	hsa-miR-645	CLIP-seq
MIRT2288740	hsa-miR-647	CLIP-seq
MIRT2288741	hsa-miR-650	CLIP-seq
MIRT2288742	hsa-miR-671-5p	CLIP-seq
MIRT2288743	hsa-miR-7	CLIP-seq
MIRT738860	hsa-miR-761	CLIP-seq
MIRT2288744	hsa-miR-762	CLIP-seq
MIRT2288745	hsa-miR-873	CLIP-seq
MIRT2288746	hsa-miR-892a	CLIP-seq
MIRT738862	hsa-miR-922	CLIP-seq
MIRT2288747	hsa-miR-924	CLIP-seq
MIRT2288748	hsa-miR-939	CLIP-seq
MIRT2288749	hsa-miR-940	CLIP-seq
MIRT2465794	hsa-miR-1264	CLIP-seq
MIRT2465795	hsa-miR-1324	CLIP-seq
MIRT2465796	hsa-miR-3925-3p	CLIP-seq
MIRT2465797	hsa-miR-618	CLIP-seq
MIRT2465798	hsa-miR-766	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000791	Component	Euchromatin	IDA	22853951
GO:0004668	Function	Protein-arginine deiminase activity	IDA	12392711, 15629448, 18645041, 25621824
GO:0004668	Function	Protein-arginine deiminase activity	IEA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	12392711
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006338	Process	Chromatin remodeling	IBA
GO:0016787	Function	Hydrolase activity	IEA
GO:0021762	Process	Substantia nigra development	HEP	22926577
GO:0030331	Function	Nuclear estrogen receptor binding	IPI	22853951
GO:0030520	Process	Estrogen receptor signaling pathway	IMP	22853951
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0042803	Function	Protein homodimerization activity	IDA	25621824
GO:0045815	Process	Transcription initiation-coupled chromatin remodeling	IMP	22853951
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070100	Process	Negative regulation of chemokine-mediated signaling pathway	IDA	18645041
GO:0140794	Function	Histone arginine deiminase activity	IBA
GO:0140798	Function	Histone H3R26 arginine deiminase activity	IDA	22853951
GO:1901624	Process	Negative regulation of lymphocyte chemotaxis	IDA	18645041
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA

MIM	HGNC	e!Ensembl
607935	18341	ENSG00000117115

Q9Y2J8

Protein name

Protein-arginine deiminase type-2 (EC 3.5.3.15) (PAD-H19) (Peptidylarginine deiminase II) (Protein-arginine deiminase type II)

Protein function

Catalyzes the deimination of arginine residues of proteins.

PDB

4N20 , 4N22 , 4N24 , 4N25 , 4N26 , 4N28 , 4N2A , 4N2B , 4N2C , 4N2D , 4N2E , 4N2F , 4N2G , 4N2H , 4N2I , 4N2K , 4N2L , 4N2M , 4N2N , 9B96 , 9B97 , 9B98

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08526	PAD_N	1 → 114	Protein-arginine deiminase (PAD) N-terminal domain	Domain
PF08527	PAD_M	116 → 274	Protein-arginine deiminase (PAD) middle domain	Domain
PF03068	PAD	284 → 662	Protein-arginine deiminase (PAD)	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in keratinocytes in epidermis (at protein level). {ECO:0000269|PubMed:12392711}.

Sequence

MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEE
VATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQAGLFLTAIEISL
DVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKD
MSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVK
YTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDIPLTPIFTDTVIFRIAPWIMT
PNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYLNRGDRWIQDEIEFGYIEA
PHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFESVTSLDSFGNLEVSPPVTVN
GKTYPLGRILIGSSFPLSGGRRMTKVVRDFLKAQQVQAPVELYSDWLTVGHVDEFMSFVP
IPGTKKFLLLMASTSACYKLFREKQKDGHGEAIMFKGLGGMSSKRITINKILSNESLVQE
NLYFQRCLDWNRDILKKELGLTEQDIIDLPALFKMDEDHRARAFFPNMVNMIVLDKDLGI
PKPFGPQVEEECCLEMHVRGLLEPLGLECTFIDDISAYHKFLGEVHCGTNVRRKPFTFKW
WHMVP

Sequence length

665

Interactions

View interactions

	Reactome
			Chromatin modifying enzymes Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Abnormal pulmonary interstitial morphology	association	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROPHARYNX CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARALYTIC STRABISMUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid arthritis	association	ClinVar Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)

Show/Hide Text Mining Associations (80)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis	Arthritis	BEFREE	17968929, 28188029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	17968929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15020330, 17968929, 21859690, 22614825, 24339914, 26245941, 26927695, 27765067, 30161253, 30515171, 31876120, 32255561, 34421923, 34453079, 36076933, 36973646, 37426666, 37759458 View all (3 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	30515171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	21878453, 30518690, 31292215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31267364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22911765, 28328217, 28549415, 31267364, 31601253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22911765, 25211228, 26067809, 34112737, 35737372, 37778380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27280713, 28403548	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31267364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31544692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	39442233	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	29084334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	27280713	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	38274809	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28403548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27280713, 29050308, 31268166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27280713, 28403548	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31268166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	31764615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	24339914, 26255191, 29148420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	28331341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	32248654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30071078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	30064459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	16723463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	16723463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30597867	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	29484680	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29287593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36212177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	30515171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	32629995	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	30515171	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	37759458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	30515171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37783508, 39700962	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	30518690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	30518690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	30518690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	30518690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	23562679	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22911765, 28328217, 28549415, 31601253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28331341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31544692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28819028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	28766045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31267364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25213324, 27280713, 28766045, 28819028, 30472187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28403548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25211228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	27400413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	27400413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	27400413	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17469138, 19478818, 21878453, 28328217, 28341402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	17469138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31764615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	31764615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25213324, 27280713, 28331341, 28549415, 28766045, 28819028, 31267364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	19391158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	25211228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37337170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33573274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	36361903	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	31025704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	30064459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	36076933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	30771686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	30474206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28819028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	25600626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15020330, 17968929, 22614825, 23164236, 24339914, 26255191, 26927695, 28029744, 29148420, 30161253, 30418117, 30515171		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	17968929, 18668562		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	30423114		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Schizophrenia	Schizophrenia	BEFREE	19478818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	25213324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	28766045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	LHGDN	18668562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	25213324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	27280713		★★★★★ ★☆☆☆☆ Found in Text Mining only

PADI2 (peptidyl arginine deiminase 2)