FZD10 (frizzled class receptor 10)

Gene

• Entrez ID: 11211
• Gene name: Frizzled class receptor 10
• Gene symbol: FZD10
• Synonyms (NCBI Gene): CD350, FZ-10, Fz10, FzE7, hFz10
• Chromosome: 12
• Chromosome location: 12q24.33
• Summary: This gene is a member of the frizzled gene family. Members of this family encode 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-c

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017968	hsa-miR-335-5p	Microarray	18185580
MIRT027638	hsa-miR-98-5p	Microarray	19088304
MIRT658043	hsa-miR-548aa	HITS-CLIP	23824327
MIRT658042	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT658041	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT658040	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT658043	hsa-miR-548aa	HITS-CLIP	23824327
MIRT658042	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT658041	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT658040	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT1007772	hsa-miR-4276	CLIP-seq
MIRT1007773	hsa-miR-4302	CLIP-seq
MIRT1549086	hsa-miR-2467-3p	CLIP-seq
MIRT1549087	hsa-miR-3120-5p	CLIP-seq
MIRT1549088	hsa-miR-3134	CLIP-seq
MIRT1549089	hsa-miR-3678-3p	CLIP-seq
MIRT1549090	hsa-miR-3689d	CLIP-seq
MIRT1549091	hsa-miR-431	CLIP-seq
MIRT1549092	hsa-miR-4534	CLIP-seq
MIRT1549093	hsa-miR-4652-3p	CLIP-seq
MIRT1549094	hsa-miR-4802-5p	CLIP-seq
MIRT1998556	hsa-miR-587	CLIP-seq
MIRT1998557	hsa-miR-885-5p	CLIP-seq
MIRT2232324	hsa-miR-330-3p	CLIP-seq
MIRT2232325	hsa-miR-3909	CLIP-seq
MIRT2232326	hsa-miR-518a-5p	CLIP-seq
MIRT2232327	hsa-miR-527	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	15930302, 19188438, 32296183
GO:0005615	Component	Extracellular space	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	16007199
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10448064
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0009986	Component	Cell surface	IDA	18271942
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0017147	Function	Wnt-protein binding	IBA
GO:0017147	Function	Wnt-protein binding	IEA
GO:0030182	Process	Neuron differentiation	ISS
GO:0032956	Process	Regulation of actin cytoskeleton organization	IMP	19137009
GO:0035567	Process	Non-canonical Wnt signaling pathway	IBA
GO:0035567	Process	Non-canonical Wnt signaling pathway	IMP	19137009
GO:0042813	Function	Wnt receptor activity	IDA	28733458
GO:0042813	Function	Wnt receptor activity	TAS	10448064
GO:0046330	Process	Positive regulation of JNK cascade	IMP	19137009
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	28733458
GO:0071300	Process	Cellular response to retinoic acid	ISS

Other IDs

• MIM: 606147
• HGNC: 4039
• e!Ensembl: ENSG00000111432

Protein

• UniProt ID: Q9ULW2
• Protein name: Frizzled-10 (Fz-10) (hFz10) (FzE7) (CD antigen CD350)
• Protein function: Receptor for Wnt proteins. Functions in the canonical Wnt/beta-catenin signaling pathway (By similarity). The canonical Wnt/beta-catenin signaling pathway leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumu
• PDB: 7X8Q, 7X8T
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01392	Fz	34 → 142	Fz domain	Domain
  PF01534	Frizzled	218 → 538	Frizzled/Smoothened family membrane region	Family

• Tissue specificity: TISSUE SPECIFICITY: Highest levels in the placenta and fetal kidney, followed by fetal lung and brain. In adult brain, abundantly expressed in the cerebellum, followed by cerebral cortex, medulla and spinal cord; very low levels in total brain, frontal lo
• Sequence:

  MQRPGPRLWLVLQVMGSCAAISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHEN
  QREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPI
  MEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEH
  PLKDGGPGRGGCDNPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVVWLAIWAVLCFF
  SSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRDSGQLYVI
  QEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWA
  IPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVAL
  FHIRRVMKTGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKILAAQHK
  CKMNNQTKTLDCLMAASIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQQVCSRRLK
  KKSRRKPASVITSGGIYKKAQHPQKTHHGKYEIPAQSPTCV

• Sequence length: 581

Pathways

KEGG:

mTOR signaling pathway
Wnt signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
Cushing syndrome
Alzheimer disease
Pathways of neurodegeneration - multiple diseases
Human papillomavirus infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Breast cancer
Hepatocellular carcinoma
Gastric cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
METABOLIC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenoma of large intestine	Colorectal adenoma	BEFREE	31336886		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32933173	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36764493	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33804101	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	18057535, 33485313	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30967398		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10448064, 11786918		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	31836665	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11786918, 19134005		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	19134005		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19134005, 32933173, 34059508	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28678406		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11786918		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33857857	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11786918		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	32764209	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30286088	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31275379		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11786918, 29416658, 31275379, 31349740		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10448064, 11786918		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29416658		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	22780124		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	32138771	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16007199, 19134005, 29416658		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28641578	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	26571495	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31275379		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	16007199, 16556060, 19137009, 26571495, 29884132, 29952132		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	LHGDN	19137009		★☆☆☆☆ Found in Text Mining only