Gene Gene information from NCBI Gene database.
Entrez ID 11189
Gene name CUGBP Elav-like family member 3
Gene symbol CELF3
Synonyms (NCBI Gene)
BRUNOL1CAGH4ERDA4ETR-1TNRC4
Chromosome 1
Chromosome location 1q21.3
Summary Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mR
SNPs SNP information provided by dbSNP.
1
SNP ID Visualize variation Clinical significance Consequence
rs749743024 C>A,T Likely-pathogenic Coding sequence variant, stop gained, missense variant
miRNA miRNA information provided by mirtarbase database.
226
miRTarBase ID miRNA Experiments Reference
MIRT884073 hsa-miR-1238 CLIP-seq
MIRT884074 hsa-miR-3187-3p CLIP-seq
MIRT884075 hsa-miR-3614-3p CLIP-seq
MIRT884076 hsa-miR-3689a-3p CLIP-seq
MIRT884077 hsa-miR-3689c CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
28
GO ID Ontology Definition Evidence Reference
GO:0000381 Process Regulation of alternative mRNA splicing, via spliceosome IBA
GO:0000381 Process Regulation of alternative mRNA splicing, via spliceosome IDA 11158314
GO:0000381 Process Regulation of alternative mRNA splicing, via spliceosome IEA
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
612678 11967 ENSG00000159409
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5SZQ8
Protein name CUGBP Elav-like family member 3 (CELF-3) (Bruno-like protein 1) (CAG repeat protein 4) (CUG-BP- and ETR-3-like factor 3) (ELAV-type RNA-binding protein 1) (ETR-1) (Expanded repeat domain protein CAG/CTG 4) (RNA-binding protein BRUNOL-1) (Trinucleotide rep
Protein function RNA-binding protein involved in the regulation of pre-mRNA alternative splicing. Mediates exon inclusion and/or exclusion in pre-mRNA that are subject to tissue-specific and developmentally regulated alternative splicing. Specifically activates
PDB 2DNO
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 9 78 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 97 165 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 382 452 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in brain. {ECO:0000269|PubMed:11158314}.
Sequence
MKEPDAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDS
ALKAQSALHEQKTLPGMN
RPIQVKPADSESRGEDRKLFVGMLGKQQTDEDVRKMFEPFGT
IDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGAS
SSLVVKFADTEKERG
LRRMQQVATQLGMFSPIALQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHM
AAINANGLIATPITPSSGTSTPPAIAATPVSAIPAALGVNGYSPVPTQPTGQPAPDALYP
NGVHPYPAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSLVAPAFPQPPALVAQQPPPPPQQ
QQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQS
KCFGFVSFDNPASAQAAIQAMNGFQIGMKRLK
VQLKRPKDANRPY
Sequence length 465
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
NEUROMUSCULAR DISEASES Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Colorectal Carcinoma Colorectal Cancer BEFREE 30132996
★☆☆☆☆
Found in Text Mining only
Hermaphroditism Hermaphroditism BEFREE 28648844
★☆☆☆☆
Found in Text Mining only
Lymphoma Lymphoma Pubtator 16098063 Associate
★☆☆☆☆
Found in Text Mining only
Multiple Myeloma Multiple myeloma Pubtator 16638930 Associate
★☆☆☆☆
Found in Text Mining only