Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	11188
Gene name	Nischarin
Gene symbol	NISCH
Synonyms (NCBI Gene)	I-1IR1IRAShIRAS
Chromosome	3
Chromosome location	3p21.1
Summary	This gene encodes a nonadrenergic imidazoline-1 receptor protein that localizes to the cytosol and anchors to the inner layer of the plasma membrane. The orthologous mouse protein has been shown to influence cytoskeletal organization and cell migration by

102

Show/Hide all (102)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051287	hsa-miR-16-5p	CLASH	23622248
MIRT037847	hsa-miR-455-3p	CLASH	23622248
MIRT1185906	hsa-miR-3907	CLIP-seq
MIRT1185907	hsa-miR-4660	CLIP-seq
MIRT1185908	hsa-miR-885-3p	CLIP-seq
MIRT2053911	hsa-miR-128	CLIP-seq
MIRT2053912	hsa-miR-597	CLIP-seq
MIRT2283068	hsa-miR-15a	CLIP-seq
MIRT2283069	hsa-miR-15b	CLIP-seq
MIRT2283070	hsa-miR-16	CLIP-seq
MIRT2283071	hsa-miR-195	CLIP-seq
MIRT2283072	hsa-miR-2115	CLIP-seq
MIRT2283073	hsa-miR-214	CLIP-seq
MIRT2283074	hsa-miR-3065-5p	CLIP-seq
MIRT2283075	hsa-miR-3120-3p	CLIP-seq
MIRT2283076	hsa-miR-3123	CLIP-seq
MIRT2283077	hsa-miR-3159	CLIP-seq
MIRT2283078	hsa-miR-3169	CLIP-seq
MIRT2283079	hsa-miR-3619-5p	CLIP-seq
MIRT2283080	hsa-miR-3654	CLIP-seq
MIRT2283081	hsa-miR-3664-3p	CLIP-seq
MIRT2283082	hsa-miR-378	CLIP-seq
MIRT2283083	hsa-miR-378b	CLIP-seq
MIRT2283084	hsa-miR-378c	CLIP-seq
MIRT2283085	hsa-miR-378d	CLIP-seq
MIRT2283086	hsa-miR-378e	CLIP-seq
MIRT2283087	hsa-miR-378f	CLIP-seq
MIRT2283088	hsa-miR-378h	CLIP-seq
MIRT2283089	hsa-miR-378i	CLIP-seq
MIRT2283090	hsa-miR-3925-5p	CLIP-seq
MIRT2283091	hsa-miR-422a	CLIP-seq
MIRT2283092	hsa-miR-424	CLIP-seq
MIRT2283093	hsa-miR-4438	CLIP-seq
MIRT2283094	hsa-miR-4514	CLIP-seq
MIRT2283095	hsa-miR-4515	CLIP-seq
MIRT2283096	hsa-miR-451b	CLIP-seq
MIRT2283097	hsa-miR-4524	CLIP-seq
MIRT2283098	hsa-miR-4692	CLIP-seq
MIRT2283099	hsa-miR-497	CLIP-seq
MIRT2283100	hsa-miR-503	CLIP-seq
MIRT2283101	hsa-miR-5095	CLIP-seq
MIRT2283102	hsa-miR-634	CLIP-seq
MIRT2283103	hsa-miR-646	CLIP-seq
MIRT2283104	hsa-miR-761	CLIP-seq
MIRT2439010	hsa-miR-186	CLIP-seq
MIRT2455221	hsa-miR-3155	CLIP-seq
MIRT2455222	hsa-miR-3155b	CLIP-seq
MIRT2455223	hsa-miR-3186-5p	CLIP-seq
MIRT2455224	hsa-miR-3652	CLIP-seq
MIRT2455225	hsa-miR-4430	CLIP-seq
MIRT2283093	hsa-miR-4438	CLIP-seq
MIRT2455226	hsa-miR-4638-3p	CLIP-seq
MIRT2455227	hsa-miR-484	CLIP-seq
MIRT2581296	hsa-miR-1185	CLIP-seq
MIRT2581297	hsa-miR-1229	CLIP-seq
MIRT2581298	hsa-miR-125a-5p	CLIP-seq
MIRT2581299	hsa-miR-125b	CLIP-seq
MIRT2581300	hsa-miR-1321	CLIP-seq
MIRT2581301	hsa-miR-150	CLIP-seq
MIRT2581302	hsa-miR-1538	CLIP-seq
MIRT2439010	hsa-miR-186	CLIP-seq
MIRT2581303	hsa-miR-2277-3p	CLIP-seq
MIRT2581304	hsa-miR-23a	CLIP-seq
MIRT2581305	hsa-miR-23b	CLIP-seq
MIRT2581306	hsa-miR-23c	CLIP-seq
MIRT2581307	hsa-miR-3131	CLIP-seq
MIRT2581308	hsa-miR-3184	CLIP-seq
MIRT2581309	hsa-miR-3679-5p	CLIP-seq
MIRT2581310	hsa-miR-423-5p	CLIP-seq
MIRT2581311	hsa-miR-4319	CLIP-seq
MIRT2581312	hsa-miR-4643	CLIP-seq
MIRT2581313	hsa-miR-4737	CLIP-seq
MIRT2581314	hsa-miR-4739	CLIP-seq
MIRT2581315	hsa-miR-4745-3p	CLIP-seq
MIRT2581316	hsa-miR-4756-5p	CLIP-seq
MIRT2581317	hsa-miR-483-3p	CLIP-seq
MIRT2581318	hsa-miR-539	CLIP-seq
MIRT2581319	hsa-miR-544b	CLIP-seq
MIRT2581320	hsa-miR-548ag	CLIP-seq
MIRT2581321	hsa-miR-548ai	CLIP-seq
MIRT2581322	hsa-miR-611	CLIP-seq
MIRT2581297	hsa-miR-1229	CLIP-seq
MIRT2581298	hsa-miR-125a-5p	CLIP-seq
MIRT2581299	hsa-miR-125b	CLIP-seq
MIRT2581301	hsa-miR-150	CLIP-seq
MIRT2581302	hsa-miR-1538	CLIP-seq
MIRT2439010	hsa-miR-186	CLIP-seq
MIRT2581303	hsa-miR-2277-3p	CLIP-seq
MIRT2581304	hsa-miR-23a	CLIP-seq
MIRT2581305	hsa-miR-23b	CLIP-seq
MIRT2581306	hsa-miR-23c	CLIP-seq
MIRT2581307	hsa-miR-3131	CLIP-seq
MIRT2581308	hsa-miR-3184	CLIP-seq
MIRT2581310	hsa-miR-423-5p	CLIP-seq
MIRT2581311	hsa-miR-4319	CLIP-seq
MIRT2581312	hsa-miR-4643	CLIP-seq
MIRT2581313	hsa-miR-4737	CLIP-seq
MIRT2581315	hsa-miR-4745-3p	CLIP-seq
MIRT2581317	hsa-miR-483-3p	CLIP-seq
MIRT2581318	hsa-miR-539	CLIP-seq
MIRT2581319	hsa-miR-544b	CLIP-seq
MIRT2581322	hsa-miR-611	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005178	Function	Integrin binding	IEA
GO:0005515	Function	Protein binding	IPI	23386062, 29568061
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IEA
GO:0005829	Component	Cytosol	IDA	15028622
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	15028622
GO:0005886	Component	Plasma membrane	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016601	Process	Rac protein signal transduction	IEA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030336	Process	Negative regulation of cell migration	IEA
GO:0035091	Function	Phosphatidylinositol binding	IEA
GO:0042802	Function	Identical protein binding	IPI	23386062
GO:0045171	Component	Intercellular bridge	IDA
GO:0055037	Component	Recycling endosome	IEA

MIM	HGNC	e!Ensembl
615507	18006	ENSG00000010322

Q9Y2I1

Protein name

Nischarin (Imidazoline receptor 1) (I-1) (IR1) (Imidazoline receptor antisera-selected protein) (hIRAS) (Imidazoline-1 receptor) (I1R) (Imidazoline-1 receptor candidate protein) (I-1 receptor candidate protein) (I1R candidate protein)

Protein function

Acts either as the functional imidazoline-1 receptor (I1R) candidate or as a membrane-associated mediator of the I1R signaling. Binds numerous imidazoline ligands that induces initiation of cell-signaling cascades triggering to cell survival, gr

PDB

3P0C , 8ESF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00787	PX	36 → 118	PX domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1, isoform 3 and isoform 4 are expressed in brain. Isoform 1 is expressed in endocrine tissues. {ECO:0000269|PubMed:15028621, ECO:0000269|PubMed:9851558}.

Sequence

MATARTFGPEREAEPAKEARVVGSELVDTYTVYIIQVTDGSHEWTVKHRYSDFHDLHEKL
VAERKIDKNLLPPKKIIGKNSRSLVEKREKDLEVYLQKLLAAFPGVTPRVLAHFLHFHFY
EINGITAALAEELFEKGEQLLGAGEVFAIGPLQLYAVTEQLQQGKPTCASGDAKTDLGHI
LDFTCRLKYLKVSGTEGPFGTSNIQEQLLPFDLSIFKSLHQVEISHCDAKHIRGLVASKP
TLATLSVRFSATSMKEVLVPEASEFDEWEPEGTTLEGPVTAVIPTWQALTTLDLSHNSVS
EIDESVKLIPKIEFLDLSHNGLLVVDNLQHLYNLVHLDLSYNKLSSLEGLHTKLGNIKTL
NLAGNLLESLSGLHKLYSLVNLDLRDNRIEQMEEVRSIGSLPCLEHVSLLNNPLSIIPDY
RTKVLAQFGERASEVCLDDTVTTEKELDTVEVLKAIQKAKEVKSKLSNPEKKGGEDSRLS
AAPCIRPSSSPPTVAPASASLPQPILSNQGIMFVQEEALASSLSSTDSLTPEHQPIAQGC
SDSLESIPAGQAASDDLRDVPGAVGGASPEHAEPEVQVVPGSGQIIFLPFTCIGYTATNQ
DFIQRLSTLIRQAIERQLPAWIEAANQREEGQGEQGEEEDEEEEEEEDVAENRYFEMGPP
DVEEEEGGGQGEEEEEEEEDEEAEEERLALEWALGADEDFLLEHIRILKVLWCFLIHVQG
SIRQFAACLVLTDFGIAVFEIPHQESRGSSQHILSSLRFVFCFPHGDLTEFGFLMPELCL
VLKVRHSENTLFIISDAANLHEFHADLRSCFAPQHMAMLCSPILYGSHTSLQEFLRQLLT
FYKVAGGCQERSQGCFPVYLVYSDKRMVQTAAGDYSGNIEWASCTLCSAVRRSCCAPSEA
VKSAAIPYWLLLTPQHLNVIKADFNPMPNRGTHNCRNRNSFKLSRVPLSTVLLDPTRSCT
QPRGAFADGHVLELLVGYRFVTAIFVLPHEKFHFLRVYNQLRASLQDLKTVVIAKTPGTG
GSPQGSFADGQPAERRASNDQRPQEVPAEALAPAPAEVPAPAPAAASASGPAKTPAPAEA
STSALVPEETPVEAPAPPPAEAPAQYPSEHLIQATSEENQIPSHLPACPSLRHVASLRGS
AIIELFHSSIAEVENEELRHLMWSSVVFYQTPGLEVTACVLLSTKAVYFVLHDGLRRYFS
EPLQDFWHQKNTDYNNSPFHISQCFVLKLSDLQSVNVGLFDQHFRLTGSTPMQVVTCLTR
DSYLTHCFLQHLMVVLSSLERTPSPEPVDKDFYSEFGNKTTGKMENYELIHSSRVKFTYP
SEEEIGDLTFTVAQKMAEPEKAPALSILLYVQAFQVGMPPPGCCRGPLRPKTLLLTSSEI
FLLDEDCVHYPLPEFAKEPPQRDRYRLDDGRRVRDLDRVLMGYQTYPQALTLVFDDVQGH
DLMGSVTLDHFGEVPGGPARASQGREVQWQVFVPSAESREKLISLLARQWEALCGRELPV
ELTG

Sequence length

1504

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BRADYCARDIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (40)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	28363452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	GWASCAT_DG	29942085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	12684185, 12882937, 14594783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	12684185, 12882937, 14594783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	30339835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	30339835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21917605, 25695373, 26392073, 28131840, 29415725, 29912916, 30635277, 30651848, 31525254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	29912916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25695373, 29415725, 29912916, 35108640	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	35108640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23503203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25724667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	22483786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	29171434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12684185, 19430760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diverticular Diseases	Diverticular Diseases	GWASCAT_DG	30177863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	LHGDN	12021582		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	12021582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	23503203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23503203	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25695373	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	27836117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21917605, 23338610, 25695373, 26392073, 28131840, 29415725, 29912916, 30635277, 30651848, 31525254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	29912916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23503203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25724667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23503203, 25695373, 25724667, 29415725, 30635277, 31525254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	29912916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21917605, 23572524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	29912916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	29912916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	30091916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21917605, 23338610, 23503203, 23572524, 25695373, 25724667, 26392073, 29415725, 30635277, 31043427, 31525254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	15843989, 16222047, 16520807, 19322589, 19360016, 30546133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	22513296	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	28806779		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25724667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	30339835		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	34727954	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28131840		★★★★★ ★☆☆☆☆ Found in Text Mining only

NISCH (nischarin)