Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	11186
Gene name	Ras association domain family member 1
Gene symbol	RASSF1
Synonyms (NCBI Gene)	123F2NORE2ARASSF1ARDA32REH3P21
Chromosome	3
Chromosome location	3p21.31
Summary	This gene encodes a protein similar to the RAS effector proteins. Loss or altered expression of this gene has been associated with the pathogenesis of a variety of cancers, which suggests the tumor suppressor function of this gene. The inactivation of thi

265

Show/Hide all (265)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006022	hsa-miR-373-3p	Luciferase reporter assayqRT-PCRWestern blot	21086164
MIRT006022	hsa-miR-373-3p	Luciferase reporter assayqRT-PCRWestern blot	21086164
MIRT006022	hsa-miR-373-3p	Luciferase reporter assayqRT-PCRWestern blot	21086164
MIRT006022	hsa-miR-373-3p	Luciferase reporter assayqRT-PCRWestern blot	21086164
MIRT006022	hsa-miR-373-3p	Luciferase reporter assayqRT-PCRWestern blot	21086164
MIRT006022	hsa-miR-373-3p	Luciferase reporter assayqRT-PCRWestern blot	21086164
MIRT016088	hsa-miR-744-5p	Sequencing	20371350
MIRT020199	hsa-miR-130b-3p	Sequencing	20371350
MIRT022310	hsa-miR-124-3p	Microarray	18668037
MIRT023590	hsa-miR-1-3p	Microarray	18668037
MIRT031097	hsa-miR-19b-3p	Sequencing	20371350
MIRT045120	hsa-miR-186-5p	CLASH	23622248
MIRT1292630	hsa-miR-1285	CLIP-seq
MIRT1292631	hsa-miR-2117	CLIP-seq
MIRT1292632	hsa-miR-3138	CLIP-seq
MIRT1292633	hsa-miR-3187-5p	CLIP-seq
MIRT1292634	hsa-miR-326	CLIP-seq
MIRT1292635	hsa-miR-330-5p	CLIP-seq
MIRT1292636	hsa-miR-378g	CLIP-seq
MIRT1292637	hsa-miR-4270	CLIP-seq
MIRT1292638	hsa-miR-4273	CLIP-seq
MIRT1292639	hsa-miR-4437	CLIP-seq
MIRT1292640	hsa-miR-4441	CLIP-seq
MIRT1292641	hsa-miR-4486	CLIP-seq
MIRT1292642	hsa-miR-4674	CLIP-seq
MIRT1292643	hsa-miR-4794	CLIP-seq
MIRT1292644	hsa-miR-552	CLIP-seq
MIRT1292645	hsa-miR-612	CLIP-seq
MIRT1292646	hsa-miR-619	CLIP-seq
MIRT1292647	hsa-miR-639	CLIP-seq
MIRT1292648	hsa-miR-10a	CLIP-seq
MIRT1292649	hsa-miR-10b	CLIP-seq
MIRT1292650	hsa-miR-1182	CLIP-seq
MIRT1292651	hsa-miR-1207-3p	CLIP-seq
MIRT1292652	hsa-miR-1224-5p	CLIP-seq
MIRT1292653	hsa-miR-1291	CLIP-seq
MIRT1292654	hsa-miR-146b-3p	CLIP-seq
MIRT1292655	hsa-miR-1825	CLIP-seq
MIRT1292656	hsa-miR-1909	CLIP-seq
MIRT1292657	hsa-miR-2355-5p	CLIP-seq
MIRT1292658	hsa-miR-3120-5p	CLIP-seq
MIRT1292659	hsa-miR-3150b-3p	CLIP-seq
MIRT1292660	hsa-miR-3182	CLIP-seq
MIRT1292661	hsa-miR-328	CLIP-seq
MIRT1292662	hsa-miR-339-5p	CLIP-seq
MIRT1292663	hsa-miR-342-3p	CLIP-seq
MIRT1292664	hsa-miR-346	CLIP-seq
MIRT1292665	hsa-miR-3612	CLIP-seq
MIRT1292666	hsa-miR-3679-3p	CLIP-seq
MIRT1292667	hsa-miR-371b-3p	CLIP-seq
MIRT1292668	hsa-miR-3915	CLIP-seq
MIRT1292669	hsa-miR-4251	CLIP-seq
MIRT1292670	hsa-miR-4286	CLIP-seq
MIRT1292671	hsa-miR-4288	CLIP-seq
MIRT1292672	hsa-miR-4303	CLIP-seq
MIRT1292673	hsa-miR-4329	CLIP-seq
MIRT1292674	hsa-miR-4459	CLIP-seq
MIRT1292675	hsa-miR-4640-5p	CLIP-seq
MIRT1292676	hsa-miR-4649-3p	CLIP-seq
MIRT1292677	hsa-miR-4652-3p	CLIP-seq
MIRT1292678	hsa-miR-4689	CLIP-seq
MIRT1292679	hsa-miR-4695-5p	CLIP-seq
MIRT1292680	hsa-miR-4717-5p	CLIP-seq
MIRT1292681	hsa-miR-4725-5p	CLIP-seq
MIRT1292682	hsa-miR-4726-5p	CLIP-seq
MIRT1292683	hsa-miR-4784	CLIP-seq
MIRT1292684	hsa-miR-490-3p	CLIP-seq
MIRT1292685	hsa-miR-504	CLIP-seq
MIRT1292686	hsa-miR-5096	CLIP-seq
MIRT1292687	hsa-miR-515-5p	CLIP-seq
MIRT1292688	hsa-miR-632	CLIP-seq
MIRT1292689	hsa-miR-650	CLIP-seq
MIRT1292674	hsa-miR-4459	CLIP-seq
MIRT2086928	hsa-miR-4512	CLIP-seq
MIRT2086929	hsa-miR-4779	CLIP-seq
MIRT1292663	hsa-miR-342-3p	CLIP-seq
MIRT2457790	hsa-miR-185	CLIP-seq
MIRT2457791	hsa-miR-3119	CLIP-seq
MIRT2457792	hsa-miR-3126-5p	CLIP-seq
MIRT2457793	hsa-miR-3622a-3p	CLIP-seq
MIRT2457794	hsa-miR-3622b-3p	CLIP-seq
MIRT2457795	hsa-miR-4306	CLIP-seq
MIRT2457796	hsa-miR-4419a	CLIP-seq
MIRT2457797	hsa-miR-4510	CLIP-seq
MIRT2457798	hsa-miR-4644	CLIP-seq
MIRT1292681	hsa-miR-4725-5p	CLIP-seq
MIRT1292685	hsa-miR-504	CLIP-seq
MIRT2457799	hsa-miR-544b	CLIP-seq
MIRT1292648	hsa-miR-10a	CLIP-seq
MIRT1292649	hsa-miR-10b	CLIP-seq
MIRT1292650	hsa-miR-1182	CLIP-seq
MIRT2608228	hsa-miR-1205	CLIP-seq
MIRT1292651	hsa-miR-1207-3p	CLIP-seq
MIRT1292652	hsa-miR-1224-5p	CLIP-seq
MIRT2608229	hsa-miR-1238	CLIP-seq
MIRT2608230	hsa-miR-124	CLIP-seq
MIRT2608231	hsa-miR-1254	CLIP-seq
MIRT2608232	hsa-miR-125a-5p	CLIP-seq
MIRT2608233	hsa-miR-125b	CLIP-seq
MIRT2608234	hsa-miR-1266	CLIP-seq
MIRT2608235	hsa-miR-181a	CLIP-seq
MIRT2608236	hsa-miR-181b	CLIP-seq
MIRT2608237	hsa-miR-181c	CLIP-seq
MIRT2608238	hsa-miR-181d	CLIP-seq
MIRT2457790	hsa-miR-185	CLIP-seq
MIRT1292656	hsa-miR-1909	CLIP-seq
MIRT2608239	hsa-miR-1915	CLIP-seq
MIRT2608240	hsa-miR-1976	CLIP-seq
MIRT1292657	hsa-miR-2355-5p	CLIP-seq
MIRT2608241	hsa-miR-2467-3p	CLIP-seq
MIRT2608242	hsa-miR-3116	CLIP-seq
MIRT1292658	hsa-miR-3120-5p	CLIP-seq
MIRT2608243	hsa-miR-3124-3p	CLIP-seq
MIRT2457792	hsa-miR-3126-5p	CLIP-seq
MIRT2608244	hsa-miR-3127-5p	CLIP-seq
MIRT2608245	hsa-miR-3130-3p	CLIP-seq
MIRT2608246	hsa-miR-3136-3p	CLIP-seq
MIRT1292659	hsa-miR-3150b-3p	CLIP-seq
MIRT1292660	hsa-miR-3182	CLIP-seq
MIRT2608247	hsa-miR-323-3p	CLIP-seq
MIRT2608248	hsa-miR-342-5p	CLIP-seq
MIRT1292664	hsa-miR-346	CLIP-seq
MIRT1292665	hsa-miR-3612	CLIP-seq
MIRT2608249	hsa-miR-3614-5p	CLIP-seq
MIRT2608250	hsa-miR-3616-3p	CLIP-seq
MIRT2457793	hsa-miR-3622a-3p	CLIP-seq
MIRT2457794	hsa-miR-3622b-3p	CLIP-seq
MIRT2608251	hsa-miR-3664-3p	CLIP-seq
MIRT2608252	hsa-miR-3678-3p	CLIP-seq
MIRT1292666	hsa-miR-3679-3p	CLIP-seq
MIRT2608253	hsa-miR-370	CLIP-seq
MIRT2608254	hsa-miR-3714	CLIP-seq
MIRT2608255	hsa-miR-376a	CLIP-seq
MIRT2608256	hsa-miR-376b	CLIP-seq
MIRT2608257	hsa-miR-3910	CLIP-seq
MIRT1292668	hsa-miR-3915	CLIP-seq
MIRT2608258	hsa-miR-3918	CLIP-seq
MIRT2608259	hsa-miR-4254	CLIP-seq
MIRT2608260	hsa-miR-4262	CLIP-seq
MIRT1292670	hsa-miR-4286	CLIP-seq
MIRT1292671	hsa-miR-4288	CLIP-seq
MIRT2608261	hsa-miR-4297	CLIP-seq
MIRT2608262	hsa-miR-4301	CLIP-seq
MIRT2457795	hsa-miR-4306	CLIP-seq
MIRT2608263	hsa-miR-4318	CLIP-seq
MIRT2608264	hsa-miR-4319	CLIP-seq
MIRT2457796	hsa-miR-4419a	CLIP-seq
MIRT2608265	hsa-miR-4436b-3p	CLIP-seq
MIRT1292674	hsa-miR-4459	CLIP-seq
MIRT2457797	hsa-miR-4510	CLIP-seq
MIRT2608266	hsa-miR-4518	CLIP-seq
MIRT2457798	hsa-miR-4644	CLIP-seq
MIRT1292676	hsa-miR-4649-3p	CLIP-seq
MIRT2608267	hsa-miR-4650-5p	CLIP-seq
MIRT1292677	hsa-miR-4652-3p	CLIP-seq
MIRT2608268	hsa-miR-4664-5p	CLIP-seq
MIRT2608269	hsa-miR-4677-3p	CLIP-seq
MIRT1292678	hsa-miR-4689	CLIP-seq
MIRT2608270	hsa-miR-4693-5p	CLIP-seq
MIRT1292679	hsa-miR-4695-5p	CLIP-seq
MIRT1292680	hsa-miR-4717-5p	CLIP-seq
MIRT2608271	hsa-miR-4718	CLIP-seq
MIRT2608272	hsa-miR-4721	CLIP-seq
MIRT1292681	hsa-miR-4725-5p	CLIP-seq
MIRT2608273	hsa-miR-4732-3p	CLIP-seq
MIRT2608274	hsa-miR-4753-5p	CLIP-seq
MIRT2608275	hsa-miR-4763-5p	CLIP-seq
MIRT1292683	hsa-miR-4784	CLIP-seq
MIRT2608276	hsa-miR-4786-5p	CLIP-seq
MIRT2608277	hsa-miR-4793-3p	CLIP-seq
MIRT2608278	hsa-miR-483-3p	CLIP-seq
MIRT1292685	hsa-miR-504	CLIP-seq
MIRT2608279	hsa-miR-506	CLIP-seq
MIRT1292687	hsa-miR-515-5p	CLIP-seq
MIRT2608280	hsa-miR-521	CLIP-seq
MIRT2457799	hsa-miR-544b	CLIP-seq
MIRT2608281	hsa-miR-626	CLIP-seq
MIRT1292688	hsa-miR-632	CLIP-seq
MIRT2608282	hsa-miR-637	CLIP-seq
MIRT2608283	hsa-miR-646	CLIP-seq
MIRT1292689	hsa-miR-650	CLIP-seq
MIRT2608284	hsa-miR-670	CLIP-seq
MIRT2608285	hsa-miR-767-5p	CLIP-seq
MIRT2608286	hsa-miR-769-5p	CLIP-seq
MIRT2608287	hsa-miR-892a	CLIP-seq
MIRT1292648	hsa-miR-10a	CLIP-seq
MIRT1292649	hsa-miR-10b	CLIP-seq
MIRT2608228	hsa-miR-1205	CLIP-seq
MIRT1292651	hsa-miR-1207-3p	CLIP-seq
MIRT1292652	hsa-miR-1224-5p	CLIP-seq
MIRT2608229	hsa-miR-1238	CLIP-seq
MIRT2608230	hsa-miR-124	CLIP-seq
MIRT2608231	hsa-miR-1254	CLIP-seq
MIRT2608234	hsa-miR-1266	CLIP-seq
MIRT2608235	hsa-miR-181a	CLIP-seq
MIRT2608236	hsa-miR-181b	CLIP-seq
MIRT2608237	hsa-miR-181c	CLIP-seq
MIRT2608238	hsa-miR-181d	CLIP-seq
MIRT2608239	hsa-miR-1915	CLIP-seq
MIRT2608240	hsa-miR-1976	CLIP-seq
MIRT1292657	hsa-miR-2355-5p	CLIP-seq
MIRT2608241	hsa-miR-2467-3p	CLIP-seq
MIRT2608242	hsa-miR-3116	CLIP-seq
MIRT1292658	hsa-miR-3120-5p	CLIP-seq
MIRT2608243	hsa-miR-3124-3p	CLIP-seq
MIRT2608244	hsa-miR-3127-5p	CLIP-seq
MIRT2608245	hsa-miR-3130-3p	CLIP-seq
MIRT2608246	hsa-miR-3136-3p	CLIP-seq
MIRT1292659	hsa-miR-3150b-3p	CLIP-seq
MIRT1292660	hsa-miR-3182	CLIP-seq
MIRT2608247	hsa-miR-323-3p	CLIP-seq
MIRT2608248	hsa-miR-342-5p	CLIP-seq
MIRT1292664	hsa-miR-346	CLIP-seq
MIRT1292665	hsa-miR-3612	CLIP-seq
MIRT2608249	hsa-miR-3614-5p	CLIP-seq
MIRT2608250	hsa-miR-3616-3p	CLIP-seq
MIRT2608251	hsa-miR-3664-3p	CLIP-seq
MIRT2608252	hsa-miR-3678-3p	CLIP-seq
MIRT1292666	hsa-miR-3679-3p	CLIP-seq
MIRT2608253	hsa-miR-370	CLIP-seq
MIRT2608254	hsa-miR-3714	CLIP-seq
MIRT2608255	hsa-miR-376a	CLIP-seq
MIRT2608256	hsa-miR-376b	CLIP-seq
MIRT2608257	hsa-miR-3910	CLIP-seq
MIRT1292668	hsa-miR-3915	CLIP-seq
MIRT2608258	hsa-miR-3918	CLIP-seq
MIRT2608259	hsa-miR-4254	CLIP-seq
MIRT2608260	hsa-miR-4262	CLIP-seq
MIRT1292670	hsa-miR-4286	CLIP-seq
MIRT1292671	hsa-miR-4288	CLIP-seq
MIRT2608261	hsa-miR-4297	CLIP-seq
MIRT2608262	hsa-miR-4301	CLIP-seq
MIRT2608263	hsa-miR-4318	CLIP-seq
MIRT2608265	hsa-miR-4436b-3p	CLIP-seq
MIRT1292674	hsa-miR-4459	CLIP-seq
MIRT2608266	hsa-miR-4518	CLIP-seq
MIRT1292676	hsa-miR-4649-3p	CLIP-seq
MIRT2608267	hsa-miR-4650-5p	CLIP-seq
MIRT1292677	hsa-miR-4652-3p	CLIP-seq
MIRT2608268	hsa-miR-4664-5p	CLIP-seq
MIRT2608269	hsa-miR-4677-3p	CLIP-seq
MIRT1292678	hsa-miR-4689	CLIP-seq
MIRT2608270	hsa-miR-4693-5p	CLIP-seq
MIRT1292679	hsa-miR-4695-5p	CLIP-seq
MIRT1292680	hsa-miR-4717-5p	CLIP-seq
MIRT2608271	hsa-miR-4718	CLIP-seq
MIRT2608272	hsa-miR-4721	CLIP-seq
MIRT1292681	hsa-miR-4725-5p	CLIP-seq
MIRT2608274	hsa-miR-4753-5p	CLIP-seq
MIRT2608275	hsa-miR-4763-5p	CLIP-seq
MIRT1292683	hsa-miR-4784	CLIP-seq
MIRT2608276	hsa-miR-4786-5p	CLIP-seq
MIRT2608277	hsa-miR-4793-3p	CLIP-seq
MIRT2608278	hsa-miR-483-3p	CLIP-seq
MIRT1292685	hsa-miR-504	CLIP-seq
MIRT2608279	hsa-miR-506	CLIP-seq
MIRT2608280	hsa-miR-521	CLIP-seq
MIRT2608281	hsa-miR-626	CLIP-seq
MIRT1292688	hsa-miR-632	CLIP-seq
MIRT2608282	hsa-miR-637	CLIP-seq
MIRT2608283	hsa-miR-646	CLIP-seq
MIRT1292689	hsa-miR-650	CLIP-seq
MIRT2608285	hsa-miR-767-5p	CLIP-seq
MIRT2608286	hsa-miR-769-5p	CLIP-seq
MIRT2608287	hsa-miR-892a	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
DNMT1	Unknown	24247422
SP1	Activation	19450668
SP3	Activation	19450668
TP53	Repression	21364923

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000922	Component	Spindle pole	IEA
GO:0005515	Function	Protein binding	IPI	11857081, 12762840, 14729613, 14743218, 15109305, 16810318, 18347058, 18566590, 20562859, 20920251, 21134643, 21199877, 23455924, 28514442, 32296183, 32814053, 35512704
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	14743218, 18566590
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0006974	Process	DNA damage response	IMP	18566590
GO:0007165	Process	Signal transduction	IEA
GO:0007265	Process	Ras protein signal transduction	IBA
GO:0007265	Process	Ras protein signal transduction	IDA	15109305
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	TAS	11333291
GO:0015630	Component	Microtubule cytoskeleton	IBA
GO:0015630	Component	Microtubule cytoskeleton	IDA	14743218, 18566590
GO:0031267	Function	Small GTPase binding	IEA
GO:0031398	Process	Positive regulation of protein ubiquitination	IDA	18566590
GO:0042802	Function	Identical protein binding	IPI	11857081, 20920251
GO:0046872	Function	Metal ion binding	IEA
GO:0050821	Process	Protein stabilization	IDA	18566590
GO:0051726	Process	Regulation of cell cycle	IDA	18566590
GO:1902806	Process	Regulation of cell cycle G1/S phase transition	IMP	12024041

MIM	HGNC	e!Ensembl
605082	9882	ENSG00000068028

Q9NS23

Protein name

Ras association domain-containing protein 1

Protein function

Potential tumor suppressor. Required for death receptor-dependent apoptosis. Mediates activation of STK3/MST2 and STK4/MST1 during Fas-induced apoptosis by preventing their dephosphorylation. When associated with MOAP1, promotes BAX conformation

PDB

2KZU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00788	RA	202 → 292	Ras association (RalGDS/AF-6) domain	Domain
PF16517	Nore1-SARAH	299 → 338	Novel Ras effector 1 C-terminal SARAH (Sav/Rassf/Hpo) domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform A and isoform C are ubiquitously expressed in all tissues tested, however isoform A is absent in many corresponding cancer cell lines. Isoform B is mainly expressed in hematopoietic cells. {ECO:0000269|PubMed:10888881, ECO:0000

Sequence

MSGEPELIELRELAPAGRAGKGRTRLERANALRIARGTACNPTRQLVPGRGHRFQPAGPA
THTWCDLCGDFIWGVVRKGLQCARLSADCKFTCHYRCRALVCLDCCGPRDLGWEPAVERD
TNVDEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSV
PSSKKPPSLQDARRGPGRGTSVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVV
DDPRKFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSDKALSFVLKENDSGEVNWDAF
SMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG

Sequence length

344

Interactions

View interactions

	KEGG
	Ras signaling pathway Hippo signaling pathway Hippo signaling pathway - multiple species Pathways in cancer MicroRNAs in cancer Bladder cancer Non-small cell lung cancer

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, HYPERTROPHIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEDULLOBLASTOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (378)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acoustic Neuroma	Acoustic Neuroma	LHGDN	17668224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	14871978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	26041820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11479207, 11585730, 12673680, 12702579, 12802288, 12912945, 14511407, 15541815, 15639718, 17097722, 17360030, 17606310, 18182852, 18391979, 18494062 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	12114441, 14511407, 17360030, 17967182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	15639718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	18494062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	12114441, 14511407, 15578700, 15700308, 16125301, 19846932, 19854132, 21508367, 23902976, 30723053, 31268606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	15639718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	16315018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	18783461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	15639718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	15639718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	25302792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	15711568, 18391979, 28600574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	17923875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	12467239, 15042681, 15448006, 15526363, 17080717, 18391979, 19367284, 20696638, 23284750, 25331797, 25620615, 28938637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	21274674, 22020530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	23915220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	15662588, 17395981, 19876893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	23915220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	23915220	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	14961078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	12384556, 14586413, 14688019, 16186793, 17899687, 21880625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	CTD_human_DG	21880625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	15959912, 23915220, 25302792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	12097277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anthracosis	Anthracosis	BEFREE	18086755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	15959912, 23915220, 25302792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia of Lacrimal and Salivary Glands	Aplasia of lacrimal and salivary glands	Pubtator	26125908	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	15367334, 18616639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	15367334, 18298842, 21339190	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asymmetric Septal Hypertrophy	Septal Hypertrophy	BEFREE	30951700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	26648328	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atypical Ductal Breast Hyperplasia	Breast Hyperplasia	BEFREE	21120523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atypical Teratoid Rhabdoid Tumor	Teratoid Rhabdoid Tumor	BEFREE	30142219		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30106448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	16616114, 17189407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	15289848, 25577235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	18182852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	15471559, 18182852	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11559536, 12594816, 15987713, 16849682, 17119258, 18446450, 18702824, 19172108, 19181545, 19522860, 20146887, 20800513, 22382007, 23139773, 28207521, 30142219, 31202904, 31500788 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	12594816, 15987713, 18824877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	15987713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	14586413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	16641902, 23661397, 24968695, 25482183, 26457492, 32783304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	20361264, 23160909, 25393370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11306494, 11333291, 11839581, 11880707, 12114441, 14559801, 15251938, 15251963, 15671542, 15734995, 15736067, 15788661, 15942659, 16028839, 16641902 View all (50 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	20627767	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11333291, 14735202, 34831091	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11839581, 12819009, 16641902, 17611401, 17764565, 17998253, 17998817, 18172292, 18381931, 18485221, 19153192, 19367284, 19657672, 19755643, 19829046 View all (43 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	14961078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16344548	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16606445, 17170014, 17634119, 18182852, 18469797, 18783461, 21878113, 23510689, 25040980, 26549256, 27516190	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	21036752	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11429703, 11559536, 11709729, 12067994, 12097277, 12647816, 12670917, 12692837, 12702579, 15480433, 15942659, 16007118, 16315018, 17170014, 17189407 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	15959912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	20505321	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	23284750	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	22925694	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	17170014, 18783461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12433278, 14507645, 16606445, 18161048, 20079733, 20364114, 21338215, 23594797, 25923138, 26000761, 26019036, 26881524, 27078152, 28951629, 30689554, 38062093 View all (1 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	40419121	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	18769130, 20056007, 24093668, 25331261, 28893223	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	14511407	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	11559536, 12594816, 15987713, 16849682, 17119258, 18702824, 19172108, 19181545, 19522860, 20146887, 20800513, 22382007, 23139773, 27713144, 28207521, 30142219, 31202904, 31500788 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11333291, 11429703, 12101420, 12527916, 12647816, 12794755, 14500366, 14506151, 15540210, 15700308, 15704097, 15867363, 15911247, 16125301, 16152615 View all (37 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	24460357, 25966226	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	11390984, 14735202, 16707423, 18822131, 20038516, 21713763, 26648328, 28160561, 31773698	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	17634119	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	14511407, 20193080, 21507233, 23478628, 23637996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26112163, 35491677	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	18192966	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	23284750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	15639718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	18404674, 18783461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	15639718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11668500, 21056906, 21955482, 23055343, 24116157, 24460357, 24573512, 24665911, 25966226, 28206954, 29098560, 29130987, 29670073, 29778234, 31653147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	20466412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	17899687		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	11313894, 12673680, 12702579, 12912945, 18608185, 25081722, 26320446, 28260046, 29288321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	21809394, 29288321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	12673680, 18608185, 21809394, 25081722, 26320446, 28260046, 29288321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	12384556, 14586413, 14688019, 16186793, 17899687, 21880625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	CTD_human_DG	21880625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	12399230, 15467712, 15704097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	12399230, 15761971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	15467712, 15761971, 29484968	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	23579583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	23533570	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choroid Plexus Papilloma	Choroid Plexus Papilloma	BEFREE	16616114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	12660822, 16606445, 16618406, 21145824, 23594797, 31790342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	11585766, 15375503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	30604274	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26370619, 26671036, 30045022, 30744076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	16513682, 30226276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12032847, 12370819, 12973852, 15806169, 16007118, 16012945, 16513682, 18494062, 18559504, 20131317, 21674126, 22733432, 22786759, 23009572, 23128528 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15122305, 15526363, 16369045, 16513682, 18494062, 18592002, 19404924, 20970032, 21274674, 22020530, 22880157, 23128528, 23573237, 23975090, 24500500 View all (7 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	15480433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15480433, 16918136, 18494062, 18592002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23865079	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Comedone	Comedone	BEFREE	25331261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complex Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	24068440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	17099724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	29359783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11585766, 11668500, 14667507, 14735202, 15208682, 15375503, 17634119, 18086755, 19641369, 20038516, 22520501, 26107221, 26648328, 31773698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	30604274, 30989570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	12670917, 17251440, 26334503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	15041703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Desmoplastic Medulloblastoma	Medulloblastoma	CTD_human_DG	21880625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	18539616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	24353143, 30986102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	14601057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystonic Disorders	Dystonia	Pubtator	27292796	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	20661892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	15959912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	18783461, 24068440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	16331610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	16619251, 17120618, 17170014, 18404674, 18469797, 18559504, 21111454, 24068440, 28669560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	17170014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	17170014	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	16619251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	17170014, 18469797, 31623109, 31787246, 31902687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	16051033, 16616114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	21955482, 24460357, 25966226, 29778234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	12702579, 16315018, 20795789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	16128782, 21722812, 24756244, 25886188, 27506957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	16128782, 21722812, 24756244, 25886188, 27506957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	25886188, 27506957	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	21150312, 25514805, 25886188	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	19637319, 23887284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	15467712, 15761971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	30951700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	15251963, 15942659, 20563638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrolamellar Hepatocellular Carcinoma	Hepatocellular Carcinoma	BEFREE	22415897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	12097277, 18813801, 25229773, 28123306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	17084965, 18182852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	18182852	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	14507661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	32883271	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Sarcoma	Gastrointestinal stromal tumor	BEFREE	21708825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gestational trophoblastic disease	Hydatidiform mole	BEFREE	28381180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Neoplasms	Gestational Trophoblastic Neoplasms	BEFREE	28381180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	19160099, 23705663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	19809523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19809523	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	14586413, 14743209, 15469871, 18616639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	15469871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	18616639, 21339190, 25563195, 31055025, 32783304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	14506151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	21063414	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	14961078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	20364114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	23594797	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	16937357, 18537155, 23989600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	LHGDN	16937357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	11390984, 18172292, 30049201	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	17412760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	16007118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	14961078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	14961078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Holt-Oram syndrome	Holt-Oram Syndrome	BEFREE	26750098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	15534102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	BEFREE	27021587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	23934182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	27511358	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31086178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	CTD_human_DG	19652091		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	CTD_human_DG	19652091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	15551306, 19578875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	CTD_human_DG	24146755		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30604274, 30989570		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	30604274, 36983040	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intestinal Cancer	Intestinal Cancer	BEFREE	18391979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	19695681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	15467712, 16343073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis	Intrahepatic Cholestasis	BEFREE	23579583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	11390984, 28160561	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	25613404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	15041703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	17634119, 17645803, 31773698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	17645803, 27725787, 31773698	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	15551306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	26894600	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Juvenile	Myelomonocytic leukemia	Pubtator	15801956	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15801956, 24248815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	15689228, 29538221		★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	15551306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12325038, 12433278, 12660822, 12960125, 14507645, 15704097, 15780049, 16516329, 16618406, 17289889, 17412760, 17438096, 17444856, 17549390, 17683489 View all (33 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15780049, 17683489, 18358501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	12660822, 16606445, 16618406, 18691570, 21145824, 23594797, 31790342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	16606445, 30689554	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	27078152	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	16606445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	12660822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	16444703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	10888881, 11306494, 11313894, 11429703, 11668500, 11709729, 12142046, 12527916, 15711568, 17019711, 17477876, 20877461, 21722812, 26112163, 26759237, 27034171, 29735543 View all (2 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	LHGDN	12527916, 12794755, 15540210, 15700308, 16140931, 16596198, 17606310, 18313166, 19024105, 19140316		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	16444703, 16644104, 17477876, 17876837, 19156899, 22146010, 22169480, 22591718, 23614702, 23771539, 25040980, 25719833, 26112163, 27716889, 29851970 View all (8 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	18337602		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	20193080, 20440268, 28634396	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	16258509, 19926549, 23573237, 31638213	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23478628	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	14961078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	26457492	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	14961078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	27864689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	14871978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	15551306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	14506151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	15639718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	23661397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11306494, 11313894, 11333291, 11585730, 11709729, 11839581, 11880707, 12114441, 12142046, 12222680, 14559801, 14735202, 15041725, 15251938, 15251963 View all (59 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	17120618, 18404674, 24068440, 28669560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	16128782, 21722812, 24756244, 25886188, 27506957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	18182852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	12370819, 15375503, 16555990, 27173228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	17683489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11333291, 11429703, 11585766, 12101420, 12114441, 12222680, 12455028, 12467239, 12527916, 12647816, 12794755, 14500366, 14506151, 15540210, 15700308 View all (48 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	18337602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	29538221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11668500, 20840667, 21955482, 24116157, 24460357, 24573512, 24665911, 28206954, 29098560, 29130987, 29670073, 31653147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	12802288, 26782786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of penis	Penile cancer	BEFREE	18336597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11559536, 12360410, 15289848, 17108217, 17342751, 17473182, 17606710, 17698033, 20184324, 21207416, 22672250, 22999998, 23979608, 23999928, 24001151 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12695555, 12746473, 16007118, 17608924, 22936446, 23982879, 24505629, 26005859, 26073472, 26735582, 30416662, 31547587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	19447423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	12097277, 14996725, 16889486, 22694820, 25229773, 28123306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	12594816, 15987713, 16849682, 17119258, 18702824, 19172108, 19181545, 19522860, 20146887, 20800513, 22382007, 23139773, 27713144, 28207521, 30142219, 31202904, 31500788 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	15987713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11585730, 11585766, 11965544, 12097277, 12527916, 12545168, 12584574, 12629521, 12647816, 12660822, 12673680, 12794755, 12802288, 12960125, 14500366 View all (75 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	25038505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Testicular Germ Cell Tumor	Malignant testicular germ cell tumor	BEFREE	19447423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	12673680, 18608185, 25081722, 26320446, 28260046, 29288321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26370619, 26671036, 30045022, 30744076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11313894, 11668500, 12527916, 14586413, 15448006, 15788661, 15942659, 17998817, 18485221, 19374895, 19657672, 22129206, 22266866, 22315090, 25482183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12527916, 14601057, 15251938, 15942659, 16028839, 18172292, 18483325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	12384556, 14586413, 14688019, 16186793, 16311119, 17899687, 21880625		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medulloblastoma	Medulloblastoma	CTD_human_DG	21880625		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medulloblastoma	Medulloblastoma	Pubtator	21880625	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medullomyoblastoma	Medullomyoblastoma	CTD_human_DG	21880625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	14961576		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12670917, 14961576, 15064737, 17251440, 17689283, 21660959, 23125005, 23209607, 26334503, 28207831, 30370527		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12670917, 14961576, 16912161, 17251440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	15596045, 16374457, 16510600, 19223509, 21081840, 21788308, 23209607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35941108	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	15064737, 18211945, 23125005	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanotic medulloblastoma	Medulloblastoma	CTD_human_DG	21880625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	14586413, 17695396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	17695396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	25648363	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	19326371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	11479207, 12082623		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma	Mesothelioma	CTD_human_DG	12082623, 15639718		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma	Mesothelioma	LHGDN	17920725		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma Malignant	Mesothelioma	Pubtator	22146010	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Milroy Disease	Milroy Disease	BEFREE	14616967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed Tumor, Mullerian	Mixed Tumor, Mullerian	BEFREE	16315018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	15197802, 19727727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	31013839	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	14961078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple endocrine neoplasia Type 2	Multiple Endocrine Neoplasia	BEFREE	15662588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	14616967, 15197802, 19727727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	14616967, 15197802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	15801956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	15801956	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	19193434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	31311858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	11358799, 11801549, 12632081, 15027117, 15122337, 15375500, 16096369, 16116475, 16229803, 17099724, 17201146, 17720308, 19129950, 19221469, 19450668 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	16096369, 16229803, 17201146, 19129950, 20042089, 21535891, 24197116, 25824751, 38115290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	38115290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	25331261	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10998413, 11306494, 11313894, 11333291, 11358799, 11429703, 11559536, 11585730, 11585766, 11668500, 11965544, 12032847, 12075701, 12082610, 12082624 View all (366 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	14555992, 14735202, 22457227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural crest tumor	Neural Crest Tumor	BEFREE	23125005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	14586413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11709729, 12222680, 12584574, 12629521, 14500366, 14735202, 14871978, 15623630, 16044164, 17064406, 17570703, 17899687, 18452173, 19165202, 21725203 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	14500366	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	17064406, 18298842, 19165202, 22695170, 23144874, 34820594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	17899687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	16258509, 21036752, 23429748, 28838380, 29851970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	25038505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	19793348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	25038505	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	12632081, 19221469, 21535891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11313894, 11333291, 11429703, 11709729, 11880707, 12455028, 12467239, 12527916, 12584574, 12629521, 12794755, 12839968, 12841866, 14500366, 14511407 View all (41 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	18337602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	30951700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	12527916, 18769130, 20466412, 22315090, 25331261, 28893223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	31013839	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	12792742, 26750098, 27880743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	12792742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	27880743	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	31653147		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	11313894, 11668500, 16315018, 21955482, 24116157, 24460357, 24573512, 24665911, 28206954, 29098560, 29130987, 29670073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18757082, 19962312, 21056906, 22871047, 28206954, 29670073, 31653147	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	15534102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	12802288, 26782786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	14501508, 26782786, 34629822	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	12802288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatoblastoma	Pancreatoblastoma	BEFREE	23583162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	11585766, 20553257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	12097277, 14996725, 16946009, 20535589, 21249150, 24383114, 24588959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	17395981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	BEFREE	20208994, 28600574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid neoplasm	Pubtator	20208994, 23764768, 28600574	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid Neoplasms	BEFREE	23764768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid neoplasm	Pubtator	39607643	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Penile Neoplasms	Penile Neoplasms	LHGDN	18336597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	15662588, 17395981, 19876893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	19924440, 20563638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	14871978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	22710434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11559536, 12067994, 12360410, 15289848, 17108217, 17342751, 17473182, 17606710, 17698033, 20184324, 21207416, 22672250, 22999998, 23979608, 23999928 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	27511358	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	12360410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17465221, 18076941, 18637271, 21694441, 21822036, 22672250, 24001151, 24938434, 27511358, 27576364, 29660369, 31115550, 34183450, 34581895, 38493315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17473182, 17698033, 17960617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	15375503, 16555990, 27173228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11585766, 11668500, 11965544, 12370819, 12702579, 14735202, 15208682, 16707423, 17634119, 18086755, 19641369, 26107221, 27173228, 31773698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	15375503, 17634119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	25613404, 27021587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	25613404	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	15799820, 18068703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	15799820	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	LHGDN	16186793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	36652664	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Adenoma Pleomorphic	Salivary gland disease	Pubtator	21063414	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	BEFREE	17189407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	15551306, 17538946, 22389451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	16258501, 22389451	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	17538946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	18347058, 23887284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	28991256, 30285260		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	27765918, 30744076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	12545168, 30418048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	15208682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	11313894, 11333291, 12527916, 15208682, 16444703, 17267069, 19473831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	11333291, 16444703, 31791387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12082610, 12839965, 19148529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12673680, 12702579, 12912945, 14511407, 15541815, 15689228, 15911247, 17034532, 17097722, 17360030, 17606310, 18702824, 19509163, 19764999, 19836067 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	12684417, 12839965, 16128782, 16465383, 17720308, 21722812, 23705663, 24756244, 24935575, 25886188, 28454432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22246327, 27027429, 29790687, 33786612, 37470582	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	12082610, 12142046, 22246327, 26857374, 27027429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	15551306, 19578875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12695555, 12746473, 16007118, 17608924, 21308683, 22936446, 23982879, 24505629, 26005859, 26073472, 26735582, 30416662, 31547587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	18494062	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12695555, 12746473, 18203293, 18494062, 24748501, 30106448, 33928818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	15736067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	17608924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17608924, 26735582	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	LHGDN	16329043		★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	19578875		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	14871978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	28871003, 31653608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	37508506	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer follicular	Follicular thyroid cancer	Pubtator	38203733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	12097277, 12802288, 14871978, 14996725, 16889486, 22694820, 23192464, 25229773, 28123306, 29145283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	38203733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	25229773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	14996725, 15840741, 15980887, 16889486, 20535589, 22694820, 25229773, 26457492, 28123306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	15980887, 22694820, 26457492, 38203733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	26457492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	15980887	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue Neoplasms	BEFREE	29538221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	17764565, 30003738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	17764565, 25068292, 30003738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tumors of Adrenal Cortex	Tumors Of Adrenal Cortex	BEFREE	23915220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	30604274, 30989570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	18702824, 23527093	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Diseases	Urinary Bladder Diseases	CTD_human_DG	23527093		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	17404085, 18702824, 21599969, 27814275, 31500788, 34806159	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	16639696, 31754973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23478628, 25081722	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	17251440, 17898258, 18211945, 21788308, 22447862, 29578129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	21788308	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	12839965, 15375503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	34820594, 35436013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RASSF1 (Ras association domain family member 1)