Gene Gene information from NCBI Gene database.
Entrez ID 11186
Gene name Ras association domain family member 1
Gene symbol RASSF1
Synonyms (NCBI Gene)
123F2NORE2ARASSF1ARDA32REH3P21
Chromosome 3
Chromosome location 3p21.31
Summary This gene encodes a protein similar to the RAS effector proteins. Loss or altered expression of this gene has been associated with the pathogenesis of a variety of cancers, which suggests the tumor suppressor function of this gene. The inactivation of thi
miRNA miRNA information provided by mirtarbase database.
265
miRTarBase ID miRNA Experiments Reference
MIRT006022 hsa-miR-373-3p Luciferase reporter assayqRT-PCRWestern blot 21086164
MIRT006022 hsa-miR-373-3p Luciferase reporter assayqRT-PCRWestern blot 21086164
MIRT006022 hsa-miR-373-3p Luciferase reporter assayqRT-PCRWestern blot 21086164
MIRT006022 hsa-miR-373-3p Luciferase reporter assayqRT-PCRWestern blot 21086164
MIRT006022 hsa-miR-373-3p Luciferase reporter assayqRT-PCRWestern blot 21086164
Transcription factors Transcription factors information provided by TRRUST V2 database.
4
Transcription factor Regulation Reference
DNMT1 Unknown 24247422
SP1 Activation 19450668
SP3 Activation 19450668
TP53 Repression 21364923
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
25
GO ID Ontology Definition Evidence Reference
GO:0000922 Component Spindle pole IEA
GO:0005515 Function Protein binding IPI 11857081, 12762840, 14729613, 14743218, 15109305, 16810318, 18347058, 18566590, 20562859, 20920251, 21134643, 21199877, 23455924, 28514442, 32296183, 32814053, 35512704
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 14743218, 18566590
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605082 9882 ENSG00000068028
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NS23
Protein name Ras association domain-containing protein 1
Protein function Potential tumor suppressor. Required for death receptor-dependent apoptosis. Mediates activation of STK3/MST2 and STK4/MST1 during Fas-induced apoptosis by preventing their dephosphorylation. When associated with MOAP1, promotes BAX conformation
PDB 2KZU
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00788 RA 202 292 Ras association (RalGDS/AF-6) domain Domain
PF16517 Nore1-SARAH 299 338 Novel Ras effector 1 C-terminal SARAH (Sav/Rassf/Hpo) domain Domain
Tissue specificity TISSUE SPECIFICITY: Isoform A and isoform C are ubiquitously expressed in all tissues tested, however isoform A is absent in many corresponding cancer cell lines. Isoform B is mainly expressed in hematopoietic cells. {ECO:0000269|PubMed:10888881, ECO:0000
Sequence
MSGEPELIELRELAPAGRAGKGRTRLERANALRIARGTACNPTRQLVPGRGHRFQPAGPA
THTWCDLCGDFIWGVVRKGLQCARLSADCKFTCHYRCRALVCLDCCGPRDLGWEPAVERD
TNVDEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSV
PSSKKPPSLQDARRGPGRGTSVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVV
DDPRKFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSDKALSFVLKENDS
GEVNWDAF
SMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEAL
HACPLG
Sequence length 344
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Ras signaling pathway
Hippo signaling pathway
Hippo signaling pathway - multiple species
Pathways in cancer
MicroRNAs in cancer
Bladder cancer
Non-small cell lung cancer
 
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
12
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CARCINOMA, NON-SMALL-CELL LUNG CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, HYPERTROPHIC CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acoustic Neuroma Acoustic Neuroma LHGDN 17668224
★☆☆☆☆
Found in Text Mining only
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 14871978
★☆☆☆☆
Found in Text Mining only
Acute Promyelocytic Leukemia Promyelocytic Leukemia BEFREE 26041820
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 11479207, 11585730, 12673680, 12702579, 12802288, 12912945, 14511407, 15541815, 15639718, 17097722, 17360030, 17606310, 18182852, 18391979, 18494062
View all (9 more)
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma LHGDN 12114441, 14511407, 17360030, 17967182
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma CTD_human_DG 15639718
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of large intestine Colorectal Cancer BEFREE 18494062
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 12114441, 14511407, 15578700, 15700308, 16125301, 19846932, 19854132, 21508367, 23902976, 30723053, 31268606
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma, Basal Cell Adenocarcinoma CTD_human_DG 15639718
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma, Clear Cell Adenocarcinoma BEFREE 16315018
★☆☆☆☆
Found in Text Mining only