Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	11183
Gene name	Mitogen-activated protein kinase kinase kinase kinase 5
Gene symbol	MAP4K5
Synonyms (NCBI Gene)	GCKRKHSKHS1MAPKKKK5
Chromosome	14
Chromosome location	14q22.1
Summary	This gene encodes a member of the serine/threonine protein kinase family, that is highly similar to yeast SPS1/STE20 kinase. Yeast SPS1/STE20 functions near the beginning of the MAP kinase signal cascades that is essential for yeast pheromone response. Th

210

Show/Hide all (210)

miRTarBase ID	miRNA	Experiments	Reference
MIRT536157	hsa-miR-548n	PAR-CLIP	22012620
MIRT536156	hsa-miR-548az-5p	PAR-CLIP	22012620
MIRT536155	hsa-miR-548t-5p	PAR-CLIP	22012620
MIRT536154	hsa-miR-548at-5p	PAR-CLIP	22012620
MIRT536153	hsa-miR-4667-3p	PAR-CLIP	22012620
MIRT536152	hsa-miR-3121-5p	PAR-CLIP	22012620
MIRT536151	hsa-miR-4639-5p	PAR-CLIP	22012620
MIRT440280	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT440280	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT536157	hsa-miR-548n	PAR-CLIP	22012620
MIRT536156	hsa-miR-548az-5p	PAR-CLIP	22012620
MIRT536155	hsa-miR-548t-5p	PAR-CLIP	22012620
MIRT536154	hsa-miR-548at-5p	PAR-CLIP	22012620
MIRT536153	hsa-miR-4667-3p	PAR-CLIP	22012620
MIRT536152	hsa-miR-3121-5p	PAR-CLIP	22012620
MIRT536151	hsa-miR-4639-5p	PAR-CLIP	22012620
MIRT1129599	hsa-miR-1273d	CLIP-seq
MIRT1129600	hsa-miR-130a	CLIP-seq
MIRT1129601	hsa-miR-130b	CLIP-seq
MIRT1129602	hsa-miR-204	CLIP-seq
MIRT1129603	hsa-miR-211	CLIP-seq
MIRT1129604	hsa-miR-301a	CLIP-seq
MIRT1129605	hsa-miR-301b	CLIP-seq
MIRT1129606	hsa-miR-3149	CLIP-seq
MIRT1129607	hsa-miR-3666	CLIP-seq
MIRT1129608	hsa-miR-3686	CLIP-seq
MIRT1129609	hsa-miR-410	CLIP-seq
MIRT1129610	hsa-miR-4287	CLIP-seq
MIRT1129611	hsa-miR-4295	CLIP-seq
MIRT1129612	hsa-miR-4422	CLIP-seq
MIRT1129613	hsa-miR-4432	CLIP-seq
MIRT1129614	hsa-miR-4452	CLIP-seq
MIRT1129615	hsa-miR-4477a	CLIP-seq
MIRT1129616	hsa-miR-4477b	CLIP-seq
MIRT1129617	hsa-miR-4503	CLIP-seq
MIRT1129618	hsa-miR-450b-5p	CLIP-seq
MIRT1129619	hsa-miR-454	CLIP-seq
MIRT1129620	hsa-miR-4671-3p	CLIP-seq
MIRT1129621	hsa-miR-4685-3p	CLIP-seq
MIRT1129622	hsa-miR-4738-3p	CLIP-seq
MIRT1129623	hsa-miR-4742-3p	CLIP-seq
MIRT1129624	hsa-miR-4778-5p	CLIP-seq
MIRT1129625	hsa-miR-499-5p	CLIP-seq
MIRT1129626	hsa-miR-548ag	CLIP-seq
MIRT1129627	hsa-miR-548ai	CLIP-seq
MIRT1129628	hsa-miR-579	CLIP-seq
MIRT1129629	hsa-miR-633	CLIP-seq
MIRT1129599	hsa-miR-1273d	CLIP-seq
MIRT1129600	hsa-miR-130a	CLIP-seq
MIRT1129601	hsa-miR-130b	CLIP-seq
MIRT1129630	hsa-miR-153	CLIP-seq
MIRT1129631	hsa-miR-186	CLIP-seq
MIRT1129632	hsa-miR-188-5p	CLIP-seq
MIRT1129633	hsa-miR-200b	CLIP-seq
MIRT1129634	hsa-miR-200c	CLIP-seq
MIRT1129602	hsa-miR-204	CLIP-seq
MIRT1129603	hsa-miR-211	CLIP-seq
MIRT1129635	hsa-miR-25	CLIP-seq
MIRT1129636	hsa-miR-2964a-3p	CLIP-seq
MIRT1129637	hsa-miR-298	CLIP-seq
MIRT1129604	hsa-miR-301a	CLIP-seq
MIRT1129605	hsa-miR-301b	CLIP-seq
MIRT1129638	hsa-miR-302f	CLIP-seq
MIRT1129639	hsa-miR-3121-3p	CLIP-seq
MIRT1129640	hsa-miR-3133	CLIP-seq
MIRT1129641	hsa-miR-3137	CLIP-seq
MIRT1129606	hsa-miR-3149	CLIP-seq
MIRT1129642	hsa-miR-3158-5p	CLIP-seq
MIRT1129643	hsa-miR-3180-5p	CLIP-seq
MIRT1129644	hsa-miR-32	CLIP-seq
MIRT1129645	hsa-miR-3529	CLIP-seq
MIRT1129646	hsa-miR-3606	CLIP-seq
MIRT1129647	hsa-miR-363	CLIP-seq
MIRT1129607	hsa-miR-3666	CLIP-seq
MIRT1129648	hsa-miR-367	CLIP-seq
MIRT1129649	hsa-miR-3682-5p	CLIP-seq
MIRT1129650	hsa-miR-369-3p	CLIP-seq
MIRT1129651	hsa-miR-379	CLIP-seq
MIRT1129652	hsa-miR-3976	CLIP-seq
MIRT1129609	hsa-miR-410	CLIP-seq
MIRT1129653	hsa-miR-4267	CLIP-seq
MIRT1129610	hsa-miR-4287	CLIP-seq
MIRT1129654	hsa-miR-429	CLIP-seq
MIRT1129611	hsa-miR-4295	CLIP-seq
MIRT1129655	hsa-miR-4305	CLIP-seq
MIRT1129612	hsa-miR-4422	CLIP-seq
MIRT1129613	hsa-miR-4432	CLIP-seq
MIRT1129656	hsa-miR-4451	CLIP-seq
MIRT1129614	hsa-miR-4452	CLIP-seq
MIRT1129616	hsa-miR-4477b	CLIP-seq
MIRT1129657	hsa-miR-448	CLIP-seq
MIRT1129658	hsa-miR-4495	CLIP-seq
MIRT1129618	hsa-miR-450b-5p	CLIP-seq
MIRT1129619	hsa-miR-454	CLIP-seq
MIRT1129659	hsa-miR-4650-3p	CLIP-seq
MIRT1129620	hsa-miR-4671-3p	CLIP-seq
MIRT1129660	hsa-miR-4678	CLIP-seq
MIRT1129621	hsa-miR-4685-3p	CLIP-seq
MIRT1129661	hsa-miR-4703-3p	CLIP-seq
MIRT1129662	hsa-miR-4766-5p	CLIP-seq
MIRT1129663	hsa-miR-4803	CLIP-seq
MIRT1129664	hsa-miR-491-3p	CLIP-seq
MIRT1129665	hsa-miR-495	CLIP-seq
MIRT1129625	hsa-miR-499-5p	CLIP-seq
MIRT1129666	hsa-miR-513a-5p	CLIP-seq
MIRT1129667	hsa-miR-548a-5p	CLIP-seq
MIRT1129668	hsa-miR-548ab	CLIP-seq
MIRT1129626	hsa-miR-548ag	CLIP-seq
MIRT1129627	hsa-miR-548ai	CLIP-seq
MIRT1129669	hsa-miR-548ak	CLIP-seq
MIRT1129670	hsa-miR-548b-5p	CLIP-seq
MIRT1129671	hsa-miR-548c-3p	CLIP-seq
MIRT1129672	hsa-miR-548c-5p	CLIP-seq
MIRT1129673	hsa-miR-548d-5p	CLIP-seq
MIRT1129674	hsa-miR-548h	CLIP-seq
MIRT1129675	hsa-miR-548i	CLIP-seq
MIRT1129676	hsa-miR-548j	CLIP-seq
MIRT1129677	hsa-miR-548k	CLIP-seq
MIRT1129678	hsa-miR-548l	CLIP-seq
MIRT1129679	hsa-miR-548p	CLIP-seq
MIRT1129680	hsa-miR-548w	CLIP-seq
MIRT1129681	hsa-miR-548y	CLIP-seq
MIRT1129682	hsa-miR-559	CLIP-seq
MIRT1129683	hsa-miR-570	CLIP-seq
MIRT1129628	hsa-miR-579	CLIP-seq
MIRT1129684	hsa-miR-586	CLIP-seq
MIRT1129685	hsa-miR-92a	CLIP-seq
MIRT1129686	hsa-miR-92b	CLIP-seq
MIRT2036941	hsa-miR-520d-5p	CLIP-seq
MIRT2036942	hsa-miR-524-5p	CLIP-seq
MIRT1129606	hsa-miR-3149	CLIP-seq
MIRT2267033	hsa-miR-3662	CLIP-seq
MIRT2267034	hsa-miR-4795-3p	CLIP-seq
MIRT2566711	hsa-miR-103b	CLIP-seq
MIRT2566712	hsa-miR-1305	CLIP-seq
MIRT2566713	hsa-miR-1343	CLIP-seq
MIRT1129632	hsa-miR-188-5p	CLIP-seq
MIRT1129602	hsa-miR-204	CLIP-seq
MIRT1129603	hsa-miR-211	CLIP-seq
MIRT2566714	hsa-miR-3074-5p	CLIP-seq
MIRT2566715	hsa-miR-3125	CLIP-seq
MIRT2566716	hsa-miR-3127-3p	CLIP-seq
MIRT1129641	hsa-miR-3137	CLIP-seq
MIRT2566717	hsa-miR-3182	CLIP-seq
MIRT2566718	hsa-miR-329	CLIP-seq
MIRT2566719	hsa-miR-362-3p	CLIP-seq
MIRT1129608	hsa-miR-3686	CLIP-seq
MIRT2566720	hsa-miR-3690	CLIP-seq
MIRT2566721	hsa-miR-3916	CLIP-seq
MIRT2566722	hsa-miR-3941	CLIP-seq
MIRT2566723	hsa-miR-4254	CLIP-seq
MIRT2566724	hsa-miR-4263	CLIP-seq
MIRT1129610	hsa-miR-4287	CLIP-seq
MIRT1129613	hsa-miR-4432	CLIP-seq
MIRT1129616	hsa-miR-4477b	CLIP-seq
MIRT1129621	hsa-miR-4685-3p	CLIP-seq
MIRT1129661	hsa-miR-4703-3p	CLIP-seq
MIRT1129623	hsa-miR-4742-3p	CLIP-seq
MIRT2566725	hsa-miR-4759	CLIP-seq
MIRT1129663	hsa-miR-4803	CLIP-seq
MIRT1129625	hsa-miR-499-5p	CLIP-seq
MIRT2036941	hsa-miR-520d-5p	CLIP-seq
MIRT2036942	hsa-miR-524-5p	CLIP-seq
MIRT1129626	hsa-miR-548ag	CLIP-seq
MIRT1129627	hsa-miR-548ai	CLIP-seq
MIRT2566726	hsa-miR-548u	CLIP-seq
MIRT1129683	hsa-miR-570	CLIP-seq
MIRT2566727	hsa-miR-603	CLIP-seq
MIRT2566728	hsa-miR-877	CLIP-seq
MIRT2566729	hsa-miR-892a	CLIP-seq
MIRT2566712	hsa-miR-1305	CLIP-seq
MIRT1129632	hsa-miR-188-5p	CLIP-seq
MIRT1129602	hsa-miR-204	CLIP-seq
MIRT2684556	hsa-miR-2053	CLIP-seq
MIRT1129603	hsa-miR-211	CLIP-seq
MIRT2566716	hsa-miR-3127-3p	CLIP-seq
MIRT1129641	hsa-miR-3137	CLIP-seq
MIRT2684557	hsa-miR-3163	CLIP-seq
MIRT2566717	hsa-miR-3182	CLIP-seq
MIRT2566718	hsa-miR-329	CLIP-seq
MIRT2684558	hsa-miR-340	CLIP-seq
MIRT2566719	hsa-miR-362-3p	CLIP-seq
MIRT1129608	hsa-miR-3686	CLIP-seq
MIRT2566722	hsa-miR-3941	CLIP-seq
MIRT2566724	hsa-miR-4263	CLIP-seq
MIRT1129610	hsa-miR-4287	CLIP-seq
MIRT1129613	hsa-miR-4432	CLIP-seq
MIRT1129616	hsa-miR-4477b	CLIP-seq
MIRT1129617	hsa-miR-4503	CLIP-seq
MIRT1129621	hsa-miR-4685-3p	CLIP-seq
MIRT1129661	hsa-miR-4703-3p	CLIP-seq
MIRT2684559	hsa-miR-4729	CLIP-seq
MIRT2684560	hsa-miR-4733-5p	CLIP-seq
MIRT1129622	hsa-miR-4738-3p	CLIP-seq
MIRT1129623	hsa-miR-4742-3p	CLIP-seq
MIRT2684561	hsa-miR-4760-3p	CLIP-seq
MIRT1129624	hsa-miR-4778-5p	CLIP-seq
MIRT1129663	hsa-miR-4803	CLIP-seq
MIRT1129625	hsa-miR-499-5p	CLIP-seq
MIRT2036941	hsa-miR-520d-5p	CLIP-seq
MIRT2036942	hsa-miR-524-5p	CLIP-seq
MIRT1129626	hsa-miR-548ag	CLIP-seq
MIRT1129627	hsa-miR-548ai	CLIP-seq
MIRT2684562	hsa-miR-548g	CLIP-seq
MIRT1129679	hsa-miR-548p	CLIP-seq
MIRT1129683	hsa-miR-570	CLIP-seq
MIRT1129628	hsa-miR-579	CLIP-seq
MIRT2566727	hsa-miR-603	CLIP-seq
MIRT2684563	hsa-miR-664	CLIP-seq
MIRT2684564	hsa-miR-873	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	9038372
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	9038372
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	9788432, 17474147, 19380743, 20936779, 21706016, 28514442, 32707033, 33961781
GO:0005524	Function	ATP binding	IDA	9038372
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	9038372
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005929	Component	Cilium	IDA
GO:0008349	Function	MAP kinase kinase kinase kinase activity	IBA
GO:0008349	Function	MAP kinase kinase kinase kinase activity	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IDA	9038372
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
604923	6867	ENSG00000012983

Q9Y4K4

Protein name

Mitogen-activated protein kinase kinase kinase kinase 5 (EC 2.7.11.1) (Kinase homologous to SPS1/STE20) (KHS) (MAPK/ERK kinase kinase kinase 5) (MEK kinase kinase 5) (MEKKK 5)

Protein function

May play a role in the response to environmental stress. Appears to act upstream of the JUN N-terminal pathway.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	20 → 277	Protein kinase domain	Domain
PF00780	CNH	516 → 816	CNH domain	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed in all tissues examined, with high levels in the ovary, testis and prostate. {ECO:0000269|PubMed:9038372}.

Sequence

MEAPLRPAADILRRNPQQDYELVQRVGSGTYGDVYKARNVHTGELAAVKIIKLEPGDDFS
LIQQEIFMVKECKHCNIVAYFGSYLSREKLWICMEYCGGGSLQDIYHVTGPLSELQIAYV
CRETLQGLAYLHTKGKMHRDIKGANILLTDHGDVKLADFGVAAKITATIAKRKSFIGTPY
WMAPEVAAVEKNGGYNQLCDIWAVGITAIELGELQPPMFDLHPMRALFLMSKSNFQPPKL
KDKTKWSSTFHNFVKIALTKNPKKRPTAERLLTHTFVAQPGLSRALAVELLDKVNNPDNH
AHYTEADDDDFEPHAIIRHTIRSTNRNARAERTASEINFDKLQFEPPLRKETEARDEMGL
SSDPNFMLQWNPFVDGANTGKSTSKRAIPPPLPPKPRISSYPEDNFPDEEKASTIKHCPD
SESRAPQILRRQSSPSCGPVAETSSIGNGDGISKLMSENTEGSAQAPQLPRKKDKRDFPK
PAINGLPPTPKVLMGACFSKVFDGCPLKINCATSWIHPDTKDQYIIFGTEDGIYTLNLNE
LHEATMEQLFPRKCTWLYVINNTLMSLSVGKTFQLYSHNLIALFEHAKKPGLAAHIQTHR
FPDRILPRKFALTTKIPDTKGCHKCCIVRNPYTGHKYLCGALQSGIVLLQWYEPMQKFML
IKHFDFPLPSPLNVFEMLVIPEQEYPMVCVAISKGTESNQVVQFETINLNSASSWFTEIG
AGSQQLDSIHVTQLERDTVLVCLDKFVKIVNLQGKLKSSKKLASELSFDFRIESVVCLQD
SVLAFWKHGMQGKSFKSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPTAHSNLYILA
GHENSY

Sequence length

846

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTROCYTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUPUYTREN CONTRACTURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPASTIC PARAPLEGIA 3, AUTOSOMAL DOMINANT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (117)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	23482931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26974007		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27023625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	26433129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	GWASDB_DG	20884846, 21768215, 23263486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	GWASCAT_DG	25646370, 27899376, 31578528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	BEFREE	26290326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	26433129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	27790247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28446149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32762045	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	27023625	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	20661421, 35085396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28516783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	35999016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	35999016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	GWASCAT_DG	27790247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	26974007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholecystolithiasis	Pubtator	40428345	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	21980298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	GWASDB_DG	20383146, 22479191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	21411509, 21980298, 24535998, 30352097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22354904	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22354904, 30476131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	12601168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	24385677, 30352097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	24385677, 30352097, 31713012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	20661421, 24385677	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	21347282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	24385677, 30352097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASCAT_DG	27790247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASDB_DG	18587394, 21102463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	21102463, 26192919, 26974007, 28067908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	27153721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	16699725, 18596051, 21236713, 21511510, 21525158, 22015968, 23185617, 24918535, 28516783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	GWASCAT_DG	27790247, 31511532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	27554451, 36313769, 37524927	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	16699725, 18596051, 21236713, 21511510, 21525158, 22015968, 23185617, 24918535, 25646370, 26578543, 28516783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	19073768, 20661421, 21114848, 21236713, 21525158, 22015968, 26578543, 27322064, 27406814, 29844224, 36240780, 36585034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21525158	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	GWASCAT_DG	27790247, 31511532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes mellitus autosomal dominant type II (disorder)	Diabetes Mellitus	BEFREE	16731834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18439548, 18556336, 19073768, 20081858, 20628598, 20668700, 21114848, 21236713, 21411509, 21421807, 21569451, 22553379, 23557707, 26252223, 26599349 View all (6 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	24918535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15891936, 16401311, 16699725, 18008060, 18556336, 19241058, 20081858, 20574426, 20628598, 20668700, 20878272, 21114848, 21236713, 21411509, 21421807 View all (24 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	17463246, 22325160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	20081858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	22885922, 28869590, 29632382, 30054458, 30595370, 30718926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	24918535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	18008060, 18556336, 18853134, 19241058, 21569451, 22517333, 26432016, 29858861, 31369557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	LHGDN	18556336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	18556336, 21569451, 22517333, 31924263	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	22105854, 23022226, 24498332, 28594920, 29314568, 29648650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	22105854, 23416328, 24498332, 28594920, 29648650, 35620859, 35881683, 36904112	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	26845607, 36240780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	23275357, 27015186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	24498332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASDB_DG	20884846, 21768215, 23263486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASCAT_DG	25646370, 27899376, 31578528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	25646370, 26290326, 28642574, 28679452, 28932319, 29976226, 35633389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	12601168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	12601168	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	GWASCAT_DG	27790247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	16731834, 18556336, 21421807, 22553379, 27146014, 30257192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	18556336, 20185807, 21421807, 22553379, 30375486	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	18556336	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	20185807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type V	Hyperlipoproteinemia	Pubtator	19656773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	19056598, 20657596, 22105854, 26043229, 27403930, 32115487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	23022226, 28679452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	Pubtator	23238572, 35365700	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	17082186, 23990951	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	26192919, 28067908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	18556336, 20661421, 21525158, 21674002, 22791750, 23383164, 28225792, 32556615, 34872092, 37829557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	10794734, 30983961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	19847674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	26432016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	21980298	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	GWASCAT_DG	20383146, 29124443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	21980298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	9949177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31522654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	24498332	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	27752939, 32443539, 37686209	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	36924053	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	35999016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	22015968, 27023625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	GWASCAT_DG	27790247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Maturity onset diabetes mellitus in young	Mason type diabetes	BEFREE	18439548, 7508874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	21411509, 37829557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28385800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	18439548, 18556336, 20661421, 21114848, 21674002, 24785259, 26136510, 26174136, 31910446, 35328045, 35397593	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	18556336, 18853134, 21114848, 21511510, 21674002, 24785259, 26136510, 26799416, 27878529, 31796261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	GWASCAT_DG	21386085, 22399527, 29632305, 30382898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	GWASDB_DG	22399527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	36240780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Monogenic diabetes	Monogenic Diabetes	BEFREE	24918535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	21071687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	21071687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	25369983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	20625834, 22095588, 24477042, 24498332, 24785259, 25167786, 25597287, 27146014, 28436986, 28695325, 29314568, 29487372, 29595690, 30444569, 30646922 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	GWASCAT_DG	29385134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	12739015, 16699725, 19241058, 21511510, 21796137, 26043229, 26578543, 28436986, 29296001, 29531563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	22105854, 24477042, 26043229, 27322064, 27377425, 27752939, 28446149, 29307798, 30710115, 31924263, 36627697, 37829557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	35349660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	22015968, 27023625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	27023625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22015968, 27023625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	21511510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	27878529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	GWASCAT_DG	26974007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	31668939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	25369983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	22105854, 23022226, 23275357, 24498332, 28594920, 29314568, 29648650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26974007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urolithiasis	Urolithiasis	GWASCAT_DG	30975718		★★★★★ ★☆☆☆☆ Found in Text Mining only

MAP4K5 (mitogen-activated protein kinase kinase kinase kinase 5)