SLC2A6 (solute carrier family 2 member 6)

Gene

• Entrez ID: 11182
• Gene name: Solute carrier family 2 member 6
• Gene symbol: SLC2A6
• Synonyms (NCBI Gene): GLUT6, GLUT9, HSA011372
• Chromosome: 9
• Chromosome location: 9q34.2
• Summary: Hexose transport into mammalian cells is catalyzed by a family of membrane proteins, including SLC2A6, that contain 12 transmembrane domains and a number of critical conserved residues.[supplied by OMIM, Jul 2002]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030110	hsa-miR-26b-5p	Microarray	19088304
MIRT049817	hsa-miR-92a-3p	CLASH	23622248
MIRT619017	hsa-miR-208a-5p	HITS-CLIP	23824327
MIRT619016	hsa-miR-208b-5p	HITS-CLIP	23824327
MIRT619015	hsa-miR-500b-3p	HITS-CLIP	23824327
MIRT619014	hsa-miR-1227-3p	HITS-CLIP	23824327
MIRT619013	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT619012	hsa-miR-4715-3p	HITS-CLIP	23824327
MIRT619009	hsa-miR-4701-5p	HITS-CLIP	23824327
MIRT619011	hsa-miR-3149	HITS-CLIP	23824327
MIRT619010	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT619017	hsa-miR-208a-5p	HITS-CLIP	23824327
MIRT619016	hsa-miR-208b-5p	HITS-CLIP	23824327
MIRT619015	hsa-miR-500b-3p	HITS-CLIP	23824327
MIRT619014	hsa-miR-1227-3p	HITS-CLIP	23824327
MIRT619013	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT619012	hsa-miR-4715-3p	HITS-CLIP	23824327
MIRT619011	hsa-miR-3149	HITS-CLIP	23824327
MIRT619010	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT619009	hsa-miR-4701-5p	HITS-CLIP	23824327
MIRT619017	hsa-miR-208a-5p	HITS-CLIP	23824327
MIRT619016	hsa-miR-208b-5p	HITS-CLIP	23824327
MIRT619015	hsa-miR-500b-3p	HITS-CLIP	23824327
MIRT619014	hsa-miR-1227-3p	HITS-CLIP	23824327
MIRT619013	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT619012	hsa-miR-4715-3p	HITS-CLIP	23824327
MIRT619009	hsa-miR-4701-5p	HITS-CLIP	23824327
MIRT619011	hsa-miR-3149	HITS-CLIP	23824327
MIRT619010	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT619017	hsa-miR-208a-5p	HITS-CLIP	23824327
MIRT619016	hsa-miR-208b-5p	HITS-CLIP	23824327
MIRT619015	hsa-miR-500b-3p	HITS-CLIP	23824327
MIRT619014	hsa-miR-1227-3p	HITS-CLIP	23824327
MIRT619013	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT619012	hsa-miR-4715-3p	HITS-CLIP	23824327
MIRT619011	hsa-miR-3149	HITS-CLIP	23824327
MIRT619010	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT619009	hsa-miR-4701-5p	HITS-CLIP	23824327
MIRT1359012	hsa-miR-122	CLIP-seq
MIRT1359013	hsa-miR-130a	CLIP-seq
MIRT1359014	hsa-miR-130b	CLIP-seq
MIRT1359015	hsa-miR-145	CLIP-seq
MIRT1359016	hsa-miR-184	CLIP-seq
MIRT1359017	hsa-miR-301a	CLIP-seq
MIRT1359018	hsa-miR-301b	CLIP-seq
MIRT1359019	hsa-miR-3135b	CLIP-seq
MIRT1359020	hsa-miR-3144-5p	CLIP-seq
MIRT1359021	hsa-miR-3191	CLIP-seq
MIRT1359022	hsa-miR-3652	CLIP-seq
MIRT1359023	hsa-miR-3666	CLIP-seq
MIRT1359024	hsa-miR-4295	CLIP-seq
MIRT1359025	hsa-miR-4430	CLIP-seq
MIRT1359026	hsa-miR-454	CLIP-seq
MIRT1359027	hsa-miR-4639-3p	CLIP-seq
MIRT1359028	hsa-miR-4652-5p	CLIP-seq
MIRT1359029	hsa-miR-491-5p	CLIP-seq
MIRT1359030	hsa-miR-520d-5p	CLIP-seq
MIRT1359031	hsa-miR-524-5p	CLIP-seq
MIRT1359032	hsa-miR-552	CLIP-seq
MIRT1359033	hsa-miR-3189-5p	CLIP-seq
MIRT1359034	hsa-miR-4649-3p	CLIP-seq
MIRT1359035	hsa-miR-4663	CLIP-seq
MIRT2106301	hsa-miR-3187-3p	CLIP-seq
MIRT2106302	hsa-miR-3545-3p	CLIP-seq
MIRT2106303	hsa-miR-3663-5p	CLIP-seq
MIRT2106304	hsa-miR-4435	CLIP-seq
MIRT2106305	hsa-miR-4635	CLIP-seq
MIRT2106306	hsa-miR-4680-5p	CLIP-seq
MIRT2106307	hsa-miR-4755-3p	CLIP-seq
MIRT2106308	hsa-miR-548s	CLIP-seq
MIRT2106309	hsa-miR-588	CLIP-seq
MIRT1359013	hsa-miR-130a	CLIP-seq
MIRT1359014	hsa-miR-130b	CLIP-seq
MIRT1359017	hsa-miR-301a	CLIP-seq
MIRT1359018	hsa-miR-301b	CLIP-seq
MIRT1359023	hsa-miR-3666	CLIP-seq
MIRT1359024	hsa-miR-4295	CLIP-seq
MIRT1359026	hsa-miR-454	CLIP-seq
MIRT2330607	hsa-miR-4695-3p	CLIP-seq
MIRT1359012	hsa-miR-122	CLIP-seq
MIRT1359013	hsa-miR-130a	CLIP-seq
MIRT1359014	hsa-miR-130b	CLIP-seq
MIRT1359017	hsa-miR-301a	CLIP-seq
MIRT1359018	hsa-miR-301b	CLIP-seq
MIRT1359019	hsa-miR-3135b	CLIP-seq
MIRT2691080	hsa-miR-3622b-5p	CLIP-seq
MIRT1359022	hsa-miR-3652	CLIP-seq
MIRT1359023	hsa-miR-3666	CLIP-seq
MIRT1359024	hsa-miR-4295	CLIP-seq
MIRT1359025	hsa-miR-4430	CLIP-seq
MIRT1359026	hsa-miR-454	CLIP-seq
MIRT2330607	hsa-miR-4695-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005353	Function	Fructose transmembrane transporter activity	ISS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IDA	30431159
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006110	Process	Regulation of glycolytic process	IEA
GO:0006110	Process	Regulation of glycolytic process	IMP	30431159
GO:0008645	Process	Hexose transmembrane transport	TAS
GO:0015755	Process	Fructose transmembrane transport	ISS
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	10970791
GO:0022857	Function	Transmembrane transporter activity	IBA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0033300	Function	Dehydroascorbic acid transmembrane transporter activity	ISS
GO:0055056	Function	D-glucose transmembrane transporter activity	IDA	30431159
GO:0055056	Function	D-glucose transmembrane transporter activity	ISS
GO:0055056	Function	D-glucose transmembrane transporter activity	NAS	10970791
GO:0055056	Function	D-glucose transmembrane transporter activity	TAS
GO:0055085	Process	Transmembrane transport	IBA
GO:0055085	Process	Transmembrane transport	IEA
GO:0070837	Process	Dehydroascorbic acid transport	ISS
GO:1904659	Process	D-glucose transmembrane transport	IDA	30431159
GO:1904659	Process	D-glucose transmembrane transport	ISS

Other IDs

• MIM: 606813
• HGNC: 11011
• e!Ensembl: ENSG00000160326

Protein

• UniProt ID: Q9UGQ3
• Protein name: Solute carrier family 2, facilitated glucose transporter member 6 (Glucose transporter type 6) (GLUT-6)
• Protein function: Probable sugar transporter that acts as a regulator of glycolysis in macrophages (Probable). Does not transport glucose (PubMed:30431159).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00083	Sugar_tr	40 → 498	Sugar (and other) transporter	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in brain, spleen and peripheral blood leukocytes. {ECO:0000269|PubMed:10970791}.
• Sequence:

  MQEPLLGAEGPDYDTFPEKPPPSPGDRARVGTLQNKRVFLATFAAVLGNFSFGYALVYTS
  PVIPALERSLDPDLHLTKSQASWFGSVFTLGAAAGGLSAMILNDLLGRKLSIMFSAVPSA
  AGYALMAGAHGLWMLLLGRTLTGFAGGLTAACIPVYVSEIAPPGVRGALGATPQLMAVFG
  SLSLYALGLLLPWRWLAVAGEAPVLIMILLLSFMPNSPRFLLSRGRDEEALRALAWLRGT
  DVDVHWEFEQIQDNVRRQSSRVSWAEARAPHVCRPITVALLMRLLQQLTGITPILVYLQS
  IFDSTAVLLPPKDDAAIVGAVRLLSVLIAALTMDLAGRKVLLFVSAAIMFAANLTLGLYI
  HFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLLATMLFIMGYAVGWGPITWLL
  MSEVLPLRARGVASGLCVLASWLTAFVLTKSFLPVVSTFGLQVPFFFFAAICLVSLVFTG
  CCVPETKGRSLEQIESFFRTGRRSFLR

• Sequence length: 507

Pathways

Reactome:

Cellular hexose transport

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC STENOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC VALVE CALCIFICATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR SALIVARY GLAND CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR SALIVARY GLAND CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arteriosclerosis	Arteriosclerosis	BEFREE	25301104		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	25301104		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	26910779		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	22132964		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	18398472		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	18398472		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	18398472		★☆☆☆☆ Found in Text Mining only
Dementia, familial Danish	Dementia	BEFREE	31695625		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28969476		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	27981520		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	29664675		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	24805955		★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	25268603, 28402018, 28623927, 29379442, 29490297, 29990831, 30622589, 30843748, 30913372, 31790902		★☆☆☆☆ Found in Text Mining only
Hypouricemia, Renal, 2	Renal hypouricemia	BEFREE	24940677, 31638209		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	19926891, 20162745		★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	26607700		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	19926891, 24643436		★☆☆☆☆ Found in Text Mining only
Lesch-Nyhan Syndrome	Lesch-Nyhan Syndrome	BEFREE	29879316		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	29664675		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26910779		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16523487		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16523487		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	22913968		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	18398472		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19554504		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	19926891, 20162745		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31695625		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30972876	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29434538		★☆☆☆☆ Found in Text Mining only
Posterior reversible encephalopathy syndrome	Leukoencephalopathy	BEFREE	21536615, 24643436		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26910779		★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic Diseases	BEFREE	26910779		★☆☆☆☆ Found in Text Mining only
Renal hypouricemia	Renal Hypouricemia	BEFREE	18701466, 21536615, 22132964, 23043931, 24940677, 26500098, 29486147		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	23043931		★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	22530001	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34440660	Associate	★☆☆☆☆ Found in Text Mining only