Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	11178
Gene name	Leucine zipper tumor suppressor 1
Gene symbol	LZTS1
Synonyms (NCBI Gene)	F37FEZ1
Chromosome	8
Chromosome location	8p21.3
Summary	This gene encodes a tumor suppressor protein that is ubiquitously expressed in normal tissues. In uveal melanomas, expression of this protein is silenced in rapidly metastasizing and metastatic tumor cells but has normal expression in slowly metastasizing

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs28937897	A>G	Pathogenic	Coding sequence variant, missense variant
rs119473032	T>C	Pathogenic	Missense variant, coding sequence variant

337

Show/Hide all (337)

miRTarBase ID	miRNA	Experiments	Reference
MIRT437778	hsa-miR-135b-5p	5.0	23695671
MIRT437778	hsa-miR-135b-5p	5.0	23695671
MIRT438741	hsa-miR-214-3p	5.0	24802407
MIRT438741	hsa-miR-214-3p	5.0	24802407
MIRT438741	hsa-miR-214-3p	5.0	24802407
MIRT438741	hsa-miR-214-3p	5.0	24802407
MIRT1124436	hsa-miR-1182	CLIP-seq
MIRT1124437	hsa-miR-1207-5p	CLIP-seq
MIRT1124438	hsa-miR-1273e	CLIP-seq
MIRT1124439	hsa-miR-1299	CLIP-seq
MIRT1124440	hsa-miR-1304	CLIP-seq
MIRT1124441	hsa-miR-1343	CLIP-seq
MIRT1124442	hsa-miR-138	CLIP-seq
MIRT1124443	hsa-miR-1908	CLIP-seq
MIRT1124444	hsa-miR-1976	CLIP-seq
MIRT1124445	hsa-miR-2110	CLIP-seq
MIRT1124446	hsa-miR-2114	CLIP-seq
MIRT1124447	hsa-miR-214	CLIP-seq
MIRT1124448	hsa-miR-216a	CLIP-seq
MIRT1124449	hsa-miR-2276	CLIP-seq
MIRT1124450	hsa-miR-24	CLIP-seq
MIRT1124451	hsa-miR-3065-3p	CLIP-seq
MIRT1124452	hsa-miR-3122	CLIP-seq
MIRT1124453	hsa-miR-3153	CLIP-seq
MIRT1124454	hsa-miR-3165	CLIP-seq
MIRT1124455	hsa-miR-3180	CLIP-seq
MIRT1124456	hsa-miR-3180-3p	CLIP-seq
MIRT1124457	hsa-miR-3180-5p	CLIP-seq
MIRT1124458	hsa-miR-3182	CLIP-seq
MIRT1124459	hsa-miR-3183	CLIP-seq
MIRT1124460	hsa-miR-3194-5p	CLIP-seq
MIRT1124461	hsa-miR-3196	CLIP-seq
MIRT1124462	hsa-miR-3202	CLIP-seq
MIRT1124463	hsa-miR-326	CLIP-seq
MIRT1124464	hsa-miR-330-5p	CLIP-seq
MIRT1124465	hsa-miR-331-3p	CLIP-seq
MIRT1124466	hsa-miR-3619-5p	CLIP-seq
MIRT1124467	hsa-miR-3622a-5p	CLIP-seq
MIRT1124468	hsa-miR-3665	CLIP-seq
MIRT1124469	hsa-miR-3674	CLIP-seq
MIRT1124470	hsa-miR-3688-5p	CLIP-seq
MIRT1124471	hsa-miR-3689a-3p	CLIP-seq
MIRT1124472	hsa-miR-3689c	CLIP-seq
MIRT1124473	hsa-miR-3690	CLIP-seq
MIRT1124474	hsa-miR-3714	CLIP-seq
MIRT1124475	hsa-miR-3913-5p	CLIP-seq
MIRT1124476	hsa-miR-3935	CLIP-seq
MIRT1124477	hsa-miR-4259	CLIP-seq
MIRT1124478	hsa-miR-4269	CLIP-seq
MIRT1124479	hsa-miR-4271	CLIP-seq
MIRT1124480	hsa-miR-4284	CLIP-seq
MIRT1124481	hsa-miR-4308	CLIP-seq
MIRT1124482	hsa-miR-4313	CLIP-seq
MIRT1124483	hsa-miR-4436b-3p	CLIP-seq
MIRT1124484	hsa-miR-4437	CLIP-seq
MIRT1124485	hsa-miR-4451	CLIP-seq
MIRT1124486	hsa-miR-4456	CLIP-seq
MIRT1124487	hsa-miR-4492	CLIP-seq
MIRT1124488	hsa-miR-4498	CLIP-seq
MIRT1124489	hsa-miR-4530	CLIP-seq
MIRT1124490	hsa-miR-4533	CLIP-seq
MIRT1124491	hsa-miR-4645-5p	CLIP-seq
MIRT1124492	hsa-miR-4646-5p	CLIP-seq
MIRT1124493	hsa-miR-4667-5p	CLIP-seq
MIRT1124494	hsa-miR-4668-5p	CLIP-seq
MIRT1124495	hsa-miR-4673	CLIP-seq
MIRT1124496	hsa-miR-4674	CLIP-seq
MIRT1124497	hsa-miR-4687-3p	CLIP-seq
MIRT1124498	hsa-miR-4690-3p	CLIP-seq
MIRT1124499	hsa-miR-4690-5p	CLIP-seq
MIRT1124500	hsa-miR-4691-3p	CLIP-seq
MIRT1124501	hsa-miR-4700-5p	CLIP-seq
MIRT1124502	hsa-miR-4708-5p	CLIP-seq
MIRT1124503	hsa-miR-4715-5p	CLIP-seq
MIRT1124504	hsa-miR-4723-3p	CLIP-seq
MIRT1124505	hsa-miR-4725-3p	CLIP-seq
MIRT1124506	hsa-miR-4728-5p	CLIP-seq
MIRT1124507	hsa-miR-4732-5p	CLIP-seq
MIRT1124508	hsa-miR-4736	CLIP-seq
MIRT1124509	hsa-miR-4747-5p	CLIP-seq
MIRT1124510	hsa-miR-4755-3p	CLIP-seq
MIRT1124511	hsa-miR-4763-3p	CLIP-seq
MIRT1124512	hsa-miR-4772-3p	CLIP-seq
MIRT1124513	hsa-miR-4782-5p	CLIP-seq
MIRT1124514	hsa-miR-515-3p	CLIP-seq
MIRT1124515	hsa-miR-516b	CLIP-seq
MIRT1124516	hsa-miR-519e	CLIP-seq
MIRT1124517	hsa-miR-520a-5p	CLIP-seq
MIRT1124518	hsa-miR-525-5p	CLIP-seq
MIRT1124519	hsa-miR-543	CLIP-seq
MIRT1124520	hsa-miR-548p	CLIP-seq
MIRT1124521	hsa-miR-564	CLIP-seq
MIRT1124522	hsa-miR-637	CLIP-seq
MIRT1124523	hsa-miR-663	CLIP-seq
MIRT1124524	hsa-miR-671-5p	CLIP-seq
MIRT1124525	hsa-miR-711	CLIP-seq
MIRT1124526	hsa-miR-761	CLIP-seq
MIRT1124527	hsa-miR-762	CLIP-seq
MIRT1124528	hsa-miR-885-3p	CLIP-seq
MIRT1124529	hsa-miR-940	CLIP-seq
MIRT2035159	hsa-miR-1266	CLIP-seq
MIRT2035160	hsa-miR-1271	CLIP-seq
MIRT1124438	hsa-miR-1273e	CLIP-seq
MIRT2035161	hsa-miR-1275	CLIP-seq
MIRT1124440	hsa-miR-1304	CLIP-seq
MIRT2035162	hsa-miR-182	CLIP-seq
MIRT2035163	hsa-miR-1915	CLIP-seq
MIRT1124447	hsa-miR-214	CLIP-seq
MIRT1124448	hsa-miR-216a	CLIP-seq
MIRT1124449	hsa-miR-2276	CLIP-seq
MIRT2035164	hsa-miR-2355-5p	CLIP-seq
MIRT1124451	hsa-miR-3065-3p	CLIP-seq
MIRT1124452	hsa-miR-3122	CLIP-seq
MIRT2035165	hsa-miR-3150a-5p	CLIP-seq
MIRT2035166	hsa-miR-3150b-5p	CLIP-seq
MIRT1124454	hsa-miR-3165	CLIP-seq
MIRT1124462	hsa-miR-3202	CLIP-seq
MIRT2035167	hsa-miR-3617	CLIP-seq
MIRT1124466	hsa-miR-3619-5p	CLIP-seq
MIRT1124468	hsa-miR-3665	CLIP-seq
MIRT2035168	hsa-miR-3667-5p	CLIP-seq
MIRT2035169	hsa-miR-3672	CLIP-seq
MIRT1124471	hsa-miR-3689a-3p	CLIP-seq
MIRT1124472	hsa-miR-3689c	CLIP-seq
MIRT1124474	hsa-miR-3714	CLIP-seq
MIRT1124475	hsa-miR-3913-5p	CLIP-seq
MIRT2035170	hsa-miR-4252	CLIP-seq
MIRT2035171	hsa-miR-4270	CLIP-seq
MIRT2035172	hsa-miR-4297	CLIP-seq
MIRT2035173	hsa-miR-4433	CLIP-seq
MIRT1124483	hsa-miR-4436b-3p	CLIP-seq
MIRT2035174	hsa-miR-4441	CLIP-seq
MIRT1124486	hsa-miR-4456	CLIP-seq
MIRT2035175	hsa-miR-4476	CLIP-seq
MIRT2035176	hsa-miR-4514	CLIP-seq
MIRT2035177	hsa-miR-4518	CLIP-seq
MIRT2035178	hsa-miR-451b	CLIP-seq
MIRT2035179	hsa-miR-4525	CLIP-seq
MIRT1124491	hsa-miR-4645-5p	CLIP-seq
MIRT2035180	hsa-miR-4665-5p	CLIP-seq
MIRT1124495	hsa-miR-4673	CLIP-seq
MIRT1124498	hsa-miR-4690-3p	CLIP-seq
MIRT2035181	hsa-miR-4692	CLIP-seq
MIRT2035182	hsa-miR-4696	CLIP-seq
MIRT2035183	hsa-miR-4717-5p	CLIP-seq
MIRT2035184	hsa-miR-4723-5p	CLIP-seq
MIRT2035185	hsa-miR-4726-3p	CLIP-seq
MIRT1124506	hsa-miR-4728-5p	CLIP-seq
MIRT1124508	hsa-miR-4736	CLIP-seq
MIRT1124512	hsa-miR-4772-3p	CLIP-seq
MIRT2035186	hsa-miR-4786-5p	CLIP-seq
MIRT2035187	hsa-miR-4793-3p	CLIP-seq
MIRT2035188	hsa-miR-486-3p	CLIP-seq
MIRT2035189	hsa-miR-610	CLIP-seq
MIRT2035190	hsa-miR-625	CLIP-seq
MIRT1124522	hsa-miR-637	CLIP-seq
MIRT2035191	hsa-miR-641	CLIP-seq
MIRT2035192	hsa-miR-661	CLIP-seq
MIRT2035193	hsa-miR-665	CLIP-seq
MIRT2035194	hsa-miR-7	CLIP-seq
MIRT1124526	hsa-miR-761	CLIP-seq
MIRT2035195	hsa-miR-766	CLIP-seq
MIRT2035196	hsa-miR-769-5p	CLIP-seq
MIRT1124528	hsa-miR-885-3p	CLIP-seq
MIRT1124529	hsa-miR-940	CLIP-seq
MIRT2035197	hsa-miR-96	CLIP-seq
MIRT2265621	hsa-miR-1231	CLIP-seq
MIRT2035159	hsa-miR-1266	CLIP-seq
MIRT2035160	hsa-miR-1271	CLIP-seq
MIRT1124438	hsa-miR-1273e	CLIP-seq
MIRT2035161	hsa-miR-1275	CLIP-seq
MIRT1124442	hsa-miR-138	CLIP-seq
MIRT2035162	hsa-miR-182	CLIP-seq
MIRT1124448	hsa-miR-216a	CLIP-seq
MIRT1124449	hsa-miR-2276	CLIP-seq
MIRT2265622	hsa-miR-2861	CLIP-seq
MIRT1124451	hsa-miR-3065-3p	CLIP-seq
MIRT2265623	hsa-miR-3065-5p	CLIP-seq
MIRT1124452	hsa-miR-3122	CLIP-seq
MIRT2035165	hsa-miR-3150a-5p	CLIP-seq
MIRT2035166	hsa-miR-3150b-5p	CLIP-seq
MIRT2265624	hsa-miR-3155	CLIP-seq
MIRT2265625	hsa-miR-3155b	CLIP-seq
MIRT2265626	hsa-miR-3162-3p	CLIP-seq
MIRT1124454	hsa-miR-3165	CLIP-seq
MIRT1124462	hsa-miR-3202	CLIP-seq
MIRT2265627	hsa-miR-3646	CLIP-seq
MIRT1124468	hsa-miR-3665	CLIP-seq
MIRT2035169	hsa-miR-3672	CLIP-seq
MIRT1124471	hsa-miR-3689a-3p	CLIP-seq
MIRT1124472	hsa-miR-3689c	CLIP-seq
MIRT1124474	hsa-miR-3714	CLIP-seq
MIRT1124475	hsa-miR-3913-5p	CLIP-seq
MIRT2035170	hsa-miR-4252	CLIP-seq
MIRT2035171	hsa-miR-4270	CLIP-seq
MIRT2035174	hsa-miR-4441	CLIP-seq
MIRT2035175	hsa-miR-4476	CLIP-seq
MIRT2035177	hsa-miR-4518	CLIP-seq
MIRT2035179	hsa-miR-4525	CLIP-seq
MIRT2265628	hsa-miR-4640-5p	CLIP-seq
MIRT2035180	hsa-miR-4665-5p	CLIP-seq
MIRT1124493	hsa-miR-4667-5p	CLIP-seq
MIRT1124501	hsa-miR-4700-5p	CLIP-seq
MIRT2035183	hsa-miR-4717-5p	CLIP-seq
MIRT2035184	hsa-miR-4723-5p	CLIP-seq
MIRT2265629	hsa-miR-4726-5p	CLIP-seq
MIRT1124506	hsa-miR-4728-5p	CLIP-seq
MIRT1124508	hsa-miR-4736	CLIP-seq
MIRT1124509	hsa-miR-4747-5p	CLIP-seq
MIRT2265630	hsa-miR-4753-5p	CLIP-seq
MIRT1124510	hsa-miR-4755-3p	CLIP-seq
MIRT1124512	hsa-miR-4772-3p	CLIP-seq
MIRT2035186	hsa-miR-4786-5p	CLIP-seq
MIRT2035187	hsa-miR-4793-3p	CLIP-seq
MIRT2265631	hsa-miR-484	CLIP-seq
MIRT2265632	hsa-miR-508-5p	CLIP-seq
MIRT2265633	hsa-miR-596	CLIP-seq
MIRT2035189	hsa-miR-610	CLIP-seq
MIRT2035190	hsa-miR-625	CLIP-seq
MIRT1124522	hsa-miR-637	CLIP-seq
MIRT2035192	hsa-miR-661	CLIP-seq
MIRT2035195	hsa-miR-766	CLIP-seq
MIRT2035196	hsa-miR-769-5p	CLIP-seq
MIRT1124529	hsa-miR-940	CLIP-seq
MIRT2035197	hsa-miR-96	CLIP-seq
MIRT1124448	hsa-miR-216a	CLIP-seq
MIRT1124449	hsa-miR-2276	CLIP-seq
MIRT1124451	hsa-miR-3065-3p	CLIP-seq
MIRT1124452	hsa-miR-3122	CLIP-seq
MIRT2390439	hsa-miR-3188	CLIP-seq
MIRT1124471	hsa-miR-3689a-3p	CLIP-seq
MIRT1124472	hsa-miR-3689c	CLIP-seq
MIRT1124475	hsa-miR-3913-5p	CLIP-seq
MIRT2390440	hsa-miR-4283	CLIP-seq
MIRT2390441	hsa-miR-4489	CLIP-seq
MIRT1124487	hsa-miR-4492	CLIP-seq
MIRT1124488	hsa-miR-4498	CLIP-seq
MIRT2390442	hsa-miR-4675	CLIP-seq
MIRT2390443	hsa-miR-4741	CLIP-seq
MIRT1124512	hsa-miR-4772-3p	CLIP-seq
MIRT2390444	hsa-miR-760	CLIP-seq
MIRT1124527	hsa-miR-762	CLIP-seq
MIRT2430887	hsa-miR-3663-5p	CLIP-seq
MIRT2430888	hsa-miR-3675-5p	CLIP-seq
MIRT2390440	hsa-miR-4283	CLIP-seq
MIRT2390441	hsa-miR-4489	CLIP-seq
MIRT1124487	hsa-miR-4492	CLIP-seq
MIRT1124488	hsa-miR-4498	CLIP-seq
MIRT1124527	hsa-miR-762	CLIP-seq
MIRT2453575	hsa-miR-1909	CLIP-seq
MIRT1124447	hsa-miR-214	CLIP-seq
MIRT2453576	hsa-miR-219-2-3p	CLIP-seq
MIRT2453577	hsa-miR-2964a-3p	CLIP-seq
MIRT2453578	hsa-miR-302f	CLIP-seq
MIRT1124466	hsa-miR-3619-5p	CLIP-seq
MIRT2453579	hsa-miR-4291	CLIP-seq
MIRT2453580	hsa-miR-4468	CLIP-seq
MIRT2035176	hsa-miR-4514	CLIP-seq
MIRT2035179	hsa-miR-4525	CLIP-seq
MIRT2453581	hsa-miR-4663	CLIP-seq
MIRT2453582	hsa-miR-4680-3p	CLIP-seq
MIRT1124499	hsa-miR-4690-5p	CLIP-seq
MIRT2035181	hsa-miR-4692	CLIP-seq
MIRT2453583	hsa-miR-628-5p	CLIP-seq
MIRT1124526	hsa-miR-761	CLIP-seq
MIRT2453584	hsa-miR-922	CLIP-seq
MIRT1124447	hsa-miR-214	CLIP-seq
MIRT1124466	hsa-miR-3619-5p	CLIP-seq
MIRT1124526	hsa-miR-761	CLIP-seq
MIRT2035161	hsa-miR-1275	CLIP-seq
MIRT1124442	hsa-miR-138	CLIP-seq
MIRT1124448	hsa-miR-216a	CLIP-seq
MIRT1124449	hsa-miR-2276	CLIP-seq
MIRT1124451	hsa-miR-3065-3p	CLIP-seq
MIRT1124452	hsa-miR-3122	CLIP-seq
MIRT1124457	hsa-miR-3180-5p	CLIP-seq
MIRT2035168	hsa-miR-3667-5p	CLIP-seq
MIRT1124471	hsa-miR-3689a-3p	CLIP-seq
MIRT1124472	hsa-miR-3689c	CLIP-seq
MIRT1124474	hsa-miR-3714	CLIP-seq
MIRT1124475	hsa-miR-3913-5p	CLIP-seq
MIRT2035170	hsa-miR-4252	CLIP-seq
MIRT2565020	hsa-miR-4254	CLIP-seq
MIRT2565021	hsa-miR-4292	CLIP-seq
MIRT1124481	hsa-miR-4308	CLIP-seq
MIRT2035178	hsa-miR-451b	CLIP-seq
MIRT2035179	hsa-miR-4525	CLIP-seq
MIRT2035180	hsa-miR-4665-5p	CLIP-seq
MIRT2035182	hsa-miR-4696	CLIP-seq
MIRT2565022	hsa-miR-4701-5p	CLIP-seq
MIRT2565023	hsa-miR-4716-3p	CLIP-seq
MIRT2035184	hsa-miR-4723-5p	CLIP-seq
MIRT2565024	hsa-miR-4725-5p	CLIP-seq
MIRT1124506	hsa-miR-4728-5p	CLIP-seq
MIRT1124508	hsa-miR-4736	CLIP-seq
MIRT1124512	hsa-miR-4772-3p	CLIP-seq
MIRT2565025	hsa-miR-4779	CLIP-seq
MIRT2035187	hsa-miR-4793-3p	CLIP-seq
MIRT2565026	hsa-miR-504	CLIP-seq
MIRT2265632	hsa-miR-508-5p	CLIP-seq
MIRT1124517	hsa-miR-520a-5p	CLIP-seq
MIRT1124518	hsa-miR-525-5p	CLIP-seq
MIRT2565027	hsa-miR-588	CLIP-seq
MIRT2035190	hsa-miR-625	CLIP-seq
MIRT1124522	hsa-miR-637	CLIP-seq
MIRT2035192	hsa-miR-661	CLIP-seq
MIRT2565028	hsa-miR-670	CLIP-seq
MIRT2565029	hsa-miR-765	CLIP-seq
MIRT2035195	hsa-miR-766	CLIP-seq
MIRT1124529	hsa-miR-940	CLIP-seq
MIRT2684390	hsa-miR-10a	CLIP-seq
MIRT2684391	hsa-miR-10b	CLIP-seq
MIRT2035161	hsa-miR-1275	CLIP-seq
MIRT1124448	hsa-miR-216a	CLIP-seq
MIRT1124449	hsa-miR-2276	CLIP-seq
MIRT1124451	hsa-miR-3065-3p	CLIP-seq
MIRT1124452	hsa-miR-3122	CLIP-seq
MIRT2035168	hsa-miR-3667-5p	CLIP-seq
MIRT1124471	hsa-miR-3689a-3p	CLIP-seq
MIRT1124472	hsa-miR-3689c	CLIP-seq
MIRT1124475	hsa-miR-3913-5p	CLIP-seq
MIRT2035170	hsa-miR-4252	CLIP-seq
MIRT2035178	hsa-miR-451b	CLIP-seq
MIRT2035179	hsa-miR-4525	CLIP-seq
MIRT2035180	hsa-miR-4665-5p	CLIP-seq
MIRT2035182	hsa-miR-4696	CLIP-seq
MIRT2035184	hsa-miR-4723-5p	CLIP-seq
MIRT2565024	hsa-miR-4725-5p	CLIP-seq
MIRT1124506	hsa-miR-4728-5p	CLIP-seq
MIRT1124512	hsa-miR-4772-3p	CLIP-seq
MIRT2035187	hsa-miR-4793-3p	CLIP-seq
MIRT2565026	hsa-miR-504	CLIP-seq
MIRT2265632	hsa-miR-508-5p	CLIP-seq
MIRT2035190	hsa-miR-625	CLIP-seq
MIRT1124522	hsa-miR-637	CLIP-seq
MIRT2035192	hsa-miR-661	CLIP-seq
MIRT2035195	hsa-miR-766	CLIP-seq

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	17349584, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0016020	Component	Membrane	IEA
GO:0016242	Process	Negative regulation of macroautophagy	IMP
GO:0042995	Component	Cell projection	IEA
GO:0043197	Component	Dendritic spine	IBA
GO:0043197	Component	Dendritic spine	IEA
GO:0045202	Component	Synapse	IEA
GO:0048167	Process	Regulation of synaptic plasticity	IBA
GO:0048814	Process	Regulation of dendrite morphogenesis	IBA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0150052	Process	Regulation of postsynapse assembly	IEA

MIM	HGNC	e!Ensembl
606551	13861	ENSG00000061337

Q9Y250

Protein name

Leucine zipper putative tumor suppressor 1 (F37/esophageal cancer-related gene-coding leucine-zipper motif) (Fez1)

Protein function

Involved in the regulation of cell growth. May stabilize the active CDC2-cyclin B1 complex and thereby contribute to the regulation of the cell cycle and the prevention of uncontrolled cell proliferation. May act as a tumor suppressor. {ECO:0000

PDB

8Y1U

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06818	Fez1	380 → 565		Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in testis, prostate, spleen, thymus, ovary and brain. Detected at lower levels in heart, placenta, small intestine, colon, liver, kidney, skeletal muscle and pancreas. Not detectable in primary tumors from breast and p

Sequence

MGSVSSLISGHSFHSKHCRASQYKLRKSSHLKKLNRYSDGLLRFGFSQDSGHGKSSSKMG
KSEDFFYIKVSQKARGSHHPDYTALSSGDLGGQAGVDFDPSTPPKLMPFSNQLEMGSEKG
AVRPTAFKPVLPRSGAILHSSPESASHQLHPAPPDKPKEQELKPGLCSGALSDSGRNSMS
SLPTHSTSSSYQLDPLVTPVGPTSRFGGSAHNITQGIVLQDSNMMSLKALSFSDGGSKLG
HSNKADKGPSCVRSPISTDECSIQELEQKLLEREGALQKLQRSFEEKELASSLAYEERPR
RCRDELEGPEPKGGNKLKQASQKSQRAQQVLHLQVLQLQQEKRQLRQELESLMKEQDLLE
TKLRSYEREKTSFGPALEETQWEVCQKSGEISLLKQQLKESQTEVNAKASEILGLKAQLK
DTRGKLEGLELRTQDLEGALRTKGLELEVCENELQRKKNEAELLREKVNLLEQELQELRA
QAALARDMGPPTFPEDVPALQRELERLRAELREERQGHDQMSSGFQHERLVWKEEKEKVI
QYQKQLQQSYVAMYQRNQRLEKALQQLARGDSAGEPLEVDLEGADIPYEDIIATEI

Sequence length

596

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Esophageal squamous cell carcinoma, somatic	Pathogenic	rs28937897, rs119473032	RCV000004467 RCV000004468	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CERVICAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LZTS1-related disorder	Benign; Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PREECLAMPSIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (88)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	15876481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	GWASDB_DG	23453885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	GWASCAT_DG	23453885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bardet-Biedl Syndrome	Bardet-Biedl Syndrome	BEFREE	15649943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign neoplasm of esophagus	Benign neoplasm of esophagus	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	15522253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	23453885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11943719, 15922864, 16918124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15735004, 15876481, 18686028, 24448468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11504921, 18686028, 25813822, 35707265, 36936167, 39380996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18686028	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11410489, 11464283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32311840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of esophagus	Esophageal Carcinoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	11943719, 15922864, 16918124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15735004, 22689099, 23695671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	15357873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	15735004	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	25938461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15876481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Child Development Disorders, Pervasive	Development Disorder	GWASCAT_DG	23453885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	BEFREE	15357873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25667121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31774489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	10097140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	10097140	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	12377406		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	CGI_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Defects Congenital	Congenital heart defect	Pubtator	34324492	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	12377406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	15357873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	18439996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29321952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26653561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	15735004	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	15735004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	15357873, 25813822	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18686028	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	23453885		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	15735004, 15876481, 18686028, 24448468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	15357873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12114433, 15735004, 22689099, 23695671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15876481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11504921, 12377406, 24525428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	12377406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	11943719, 15922864, 16918124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11943719, 16012743, 17171680, 24448468, 25938461		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	18559591		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	18559591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31774489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	17374448, 17664024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	17659810	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11004673, 11410489, 11943719, 12114433, 12377406, 12851677, 15357873, 15735004, 15876481, 15922864, 17127340, 17419986, 17659675, 18686028, 20083228, 24448468, 25667121, 25938461 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	17374448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24802407		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15876481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20233889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	GWASCAT_DG	27082954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate cancer familial	Prostate cancer	Pubtator	15735004	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	BEFREE	12377406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12377406, 24525428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10097140	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	11464283		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12377406		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	12377406		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24525428	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	BEFREE	17374448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	PSYGENET_DG	22099459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	15357873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15522253, 16510495, 16936715, 17258902, 17374448, 17664024, 18647754, 22099459, 24726361, 28928414, 29249816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	15522253, 17374448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	PSYGENET_DG	16936715, 18647754, 22099459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASDB_DG	21926974, 22688191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	21926974, 22688191, 23453885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12851677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12851677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29864623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	39757032	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	25938461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11410489		★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	11943719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30655858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	31903983, 37725244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

LZTS1 (leucine zipper tumor suppressor 1)