Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	11170
Gene name	Family with sequence similarity 107 member A
Gene symbol	FAM107A
Synonyms (NCBI Gene)	DRR1TU3A
Chromosome	3
Chromosome location	3p14.3-p14.2

216

Show/Hide all (216)

miRTarBase ID	miRNA	Experiments	Reference
MIRT710276	hsa-miR-6887-3p	HITS-CLIP	19536157
MIRT710275	hsa-miR-6795-3p	HITS-CLIP	19536157
MIRT710274	hsa-miR-6752-3p	HITS-CLIP	19536157
MIRT710273	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT710272	hsa-miR-1913	HITS-CLIP	19536157
MIRT710271	hsa-miR-324-3p	HITS-CLIP	19536157
MIRT710270	hsa-miR-18a-3p	HITS-CLIP	19536157
MIRT710269	hsa-miR-7976	HITS-CLIP	19536157
MIRT710268	hsa-miR-3173-5p	HITS-CLIP	19536157
MIRT710267	hsa-miR-6799-3p	HITS-CLIP	19536157
MIRT710266	hsa-miR-146b-3p	HITS-CLIP	19536157
MIRT710265	hsa-miR-938	HITS-CLIP	19536157
MIRT710264	hsa-miR-6886-3p	HITS-CLIP	19536157
MIRT710263	hsa-miR-346	HITS-CLIP	19536157
MIRT710262	hsa-miR-6826-3p	HITS-CLIP	19536157
MIRT710261	hsa-miR-4691-5p	HITS-CLIP	19536157
MIRT710260	hsa-miR-6792-3p	HITS-CLIP	19536157
MIRT710259	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT710258	hsa-miR-874-3p	HITS-CLIP	19536157
MIRT710276	hsa-miR-6887-3p	HITS-CLIP	19536157
MIRT710275	hsa-miR-6795-3p	HITS-CLIP	19536157
MIRT710274	hsa-miR-6752-3p	HITS-CLIP	19536157
MIRT710273	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT710272	hsa-miR-1913	HITS-CLIP	19536157
MIRT710271	hsa-miR-324-3p	HITS-CLIP	19536157
MIRT710270	hsa-miR-18a-3p	HITS-CLIP	19536157
MIRT710269	hsa-miR-7976	HITS-CLIP	19536157
MIRT710268	hsa-miR-3173-5p	HITS-CLIP	19536157
MIRT710267	hsa-miR-6799-3p	HITS-CLIP	19536157
MIRT710266	hsa-miR-146b-3p	HITS-CLIP	19536157
MIRT710265	hsa-miR-938	HITS-CLIP	19536157
MIRT710264	hsa-miR-6886-3p	HITS-CLIP	19536157
MIRT710263	hsa-miR-346	HITS-CLIP	19536157
MIRT710262	hsa-miR-6826-3p	HITS-CLIP	19536157
MIRT710261	hsa-miR-4691-5p	HITS-CLIP	19536157
MIRT710260	hsa-miR-6792-3p	HITS-CLIP	19536157
MIRT710259	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT710258	hsa-miR-874-3p	HITS-CLIP	19536157
MIRT710276	hsa-miR-6887-3p	HITS-CLIP	19536157
MIRT710275	hsa-miR-6795-3p	HITS-CLIP	19536157
MIRT710274	hsa-miR-6752-3p	HITS-CLIP	19536157
MIRT710273	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT710272	hsa-miR-1913	HITS-CLIP	19536157
MIRT710271	hsa-miR-324-3p	HITS-CLIP	19536157
MIRT710270	hsa-miR-18a-3p	HITS-CLIP	19536157
MIRT710269	hsa-miR-7976	HITS-CLIP	19536157
MIRT710268	hsa-miR-3173-5p	HITS-CLIP	19536157
MIRT710267	hsa-miR-6799-3p	HITS-CLIP	19536157
MIRT710266	hsa-miR-146b-3p	HITS-CLIP	19536157
MIRT710265	hsa-miR-938	HITS-CLIP	19536157
MIRT710264	hsa-miR-6886-3p	HITS-CLIP	19536157
MIRT710263	hsa-miR-346	HITS-CLIP	19536157
MIRT710262	hsa-miR-6826-3p	HITS-CLIP	19536157
MIRT710261	hsa-miR-4691-5p	HITS-CLIP	19536157
MIRT710260	hsa-miR-6792-3p	HITS-CLIP	19536157
MIRT710259	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT710258	hsa-miR-874-3p	HITS-CLIP	19536157
MIRT626002	hsa-miR-4282	HITS-CLIP	23824327
MIRT663270	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT616583	hsa-miR-634	HITS-CLIP	23824327
MIRT616581	hsa-miR-1226-3p	HITS-CLIP	23824327
MIRT616580	hsa-miR-4530	HITS-CLIP	23824327
MIRT616579	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT626002	hsa-miR-4282	HITS-CLIP	23824327
MIRT616583	hsa-miR-634	HITS-CLIP	23824327
MIRT616582	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT616581	hsa-miR-1226-3p	HITS-CLIP	23824327
MIRT616580	hsa-miR-4530	HITS-CLIP	23824327
MIRT616579	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT663270	hsa-miR-129-5p	HITS-CLIP	27418678
MIRT663270	hsa-miR-129-5p	HITS-CLIP	27418678
MIRT663270	hsa-miR-129-5p	HITS-CLIP	27418678
MIRT663270	hsa-miR-129-5p	HITS-CLIP	27418678
MIRT626002	hsa-miR-4282	HITS-CLIP	27418678
MIRT626002	hsa-miR-4282	HITS-CLIP	27418678
MIRT626002	hsa-miR-4282	HITS-CLIP	27418678
MIRT710276	hsa-miR-6887-3p	HITS-CLIP	19536157
MIRT710275	hsa-miR-6795-3p	HITS-CLIP	19536157
MIRT710274	hsa-miR-6752-3p	HITS-CLIP	19536157
MIRT710273	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT710272	hsa-miR-1913	HITS-CLIP	19536157
MIRT710271	hsa-miR-324-3p	HITS-CLIP	19536157
MIRT710270	hsa-miR-18a-3p	HITS-CLIP	19536157
MIRT710269	hsa-miR-7976	HITS-CLIP	19536157
MIRT710268	hsa-miR-3173-5p	HITS-CLIP	19536157
MIRT710267	hsa-miR-6799-3p	HITS-CLIP	19536157
MIRT710266	hsa-miR-146b-3p	HITS-CLIP	19536157
MIRT710265	hsa-miR-938	HITS-CLIP	19536157
MIRT710264	hsa-miR-6886-3p	HITS-CLIP	19536157
MIRT710263	hsa-miR-346	HITS-CLIP	19536157
MIRT710262	hsa-miR-6826-3p	HITS-CLIP	19536157
MIRT710261	hsa-miR-4691-5p	HITS-CLIP	19536157
MIRT710260	hsa-miR-6792-3p	HITS-CLIP	19536157
MIRT710259	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT710258	hsa-miR-874-3p	HITS-CLIP	19536157
MIRT710276	hsa-miR-6887-3p	HITS-CLIP	19536157
MIRT710275	hsa-miR-6795-3p	HITS-CLIP	19536157
MIRT710274	hsa-miR-6752-3p	HITS-CLIP	19536157
MIRT710273	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT710272	hsa-miR-1913	HITS-CLIP	19536157
MIRT710271	hsa-miR-324-3p	HITS-CLIP	19536157
MIRT710270	hsa-miR-18a-3p	HITS-CLIP	19536157
MIRT710269	hsa-miR-7976	HITS-CLIP	19536157
MIRT710268	hsa-miR-3173-5p	HITS-CLIP	19536157
MIRT710267	hsa-miR-6799-3p	HITS-CLIP	19536157
MIRT710266	hsa-miR-146b-3p	HITS-CLIP	19536157
MIRT710265	hsa-miR-938	HITS-CLIP	19536157
MIRT710264	hsa-miR-6886-3p	HITS-CLIP	19536157
MIRT710263	hsa-miR-346	HITS-CLIP	19536157
MIRT710262	hsa-miR-6826-3p	HITS-CLIP	19536157
MIRT710261	hsa-miR-4691-5p	HITS-CLIP	19536157
MIRT710260	hsa-miR-6792-3p	HITS-CLIP	19536157
MIRT710259	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT710258	hsa-miR-874-3p	HITS-CLIP	19536157
MIRT710276	hsa-miR-6887-3p	HITS-CLIP	19536157
MIRT710275	hsa-miR-6795-3p	HITS-CLIP	19536157
MIRT710274	hsa-miR-6752-3p	HITS-CLIP	19536157
MIRT710273	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT710272	hsa-miR-1913	HITS-CLIP	19536157
MIRT710271	hsa-miR-324-3p	HITS-CLIP	19536157
MIRT710270	hsa-miR-18a-3p	HITS-CLIP	19536157
MIRT710269	hsa-miR-7976	HITS-CLIP	19536157
MIRT710268	hsa-miR-3173-5p	HITS-CLIP	19536157
MIRT710267	hsa-miR-6799-3p	HITS-CLIP	19536157
MIRT710266	hsa-miR-146b-3p	HITS-CLIP	19536157
MIRT710265	hsa-miR-938	HITS-CLIP	19536157
MIRT710264	hsa-miR-6886-3p	HITS-CLIP	19536157
MIRT710263	hsa-miR-346	HITS-CLIP	19536157
MIRT710262	hsa-miR-6826-3p	HITS-CLIP	19536157
MIRT710261	hsa-miR-4691-5p	HITS-CLIP	19536157
MIRT710260	hsa-miR-6792-3p	HITS-CLIP	19536157
MIRT710259	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT710258	hsa-miR-874-3p	HITS-CLIP	19536157
MIRT626002	hsa-miR-4282	HITS-CLIP	23824327
MIRT663270	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT616583	hsa-miR-634	HITS-CLIP	23824327
MIRT616581	hsa-miR-1226-3p	HITS-CLIP	23824327
MIRT616580	hsa-miR-4530	HITS-CLIP	23824327
MIRT616579	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT626002	hsa-miR-4282	HITS-CLIP	23824327
MIRT616583	hsa-miR-634	HITS-CLIP	23824327
MIRT616582	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT616581	hsa-miR-1226-3p	HITS-CLIP	23824327
MIRT616580	hsa-miR-4530	HITS-CLIP	23824327
MIRT616579	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT976692	hsa-miR-1262	CLIP-seq
MIRT976693	hsa-miR-1827	CLIP-seq
MIRT976694	hsa-miR-3127-5p	CLIP-seq
MIRT976695	hsa-miR-3167	CLIP-seq
MIRT976696	hsa-miR-4420	CLIP-seq
MIRT976697	hsa-miR-4452	CLIP-seq
MIRT976698	hsa-miR-4476	CLIP-seq
MIRT976699	hsa-miR-4506	CLIP-seq
MIRT976700	hsa-miR-4650-5p	CLIP-seq
MIRT976701	hsa-miR-4653-3p	CLIP-seq
MIRT976702	hsa-miR-4668-5p	CLIP-seq
MIRT976703	hsa-miR-4701-3p	CLIP-seq
MIRT976704	hsa-miR-4715-5p	CLIP-seq
MIRT976705	hsa-miR-4786-3p	CLIP-seq
MIRT976706	hsa-miR-571	CLIP-seq
MIRT976707	hsa-miR-629	CLIP-seq
MIRT976708	hsa-miR-651	CLIP-seq
MIRT976709	hsa-miR-671-5p	CLIP-seq
MIRT976710	hsa-miR-876-5p	CLIP-seq
MIRT976711	hsa-miR-1252	CLIP-seq
MIRT976692	hsa-miR-1262	CLIP-seq
MIRT976712	hsa-miR-3202	CLIP-seq
MIRT976696	hsa-miR-4420	CLIP-seq
MIRT976697	hsa-miR-4452	CLIP-seq
MIRT976699	hsa-miR-4506	CLIP-seq
MIRT976713	hsa-miR-4533	CLIP-seq
MIRT976701	hsa-miR-4653-3p	CLIP-seq
MIRT976703	hsa-miR-4701-3p	CLIP-seq
MIRT976706	hsa-miR-571	CLIP-seq
MIRT976714	hsa-miR-636	CLIP-seq
MIRT1548475	hsa-miR-432	CLIP-seq
MIRT1921778	hsa-miR-1226	CLIP-seq
MIRT1921779	hsa-miR-1228	CLIP-seq
MIRT1921778	hsa-miR-1226	CLIP-seq
MIRT1921779	hsa-miR-1228	CLIP-seq
MIRT1989451	hsa-miR-1236	CLIP-seq
MIRT1989452	hsa-miR-23a	CLIP-seq
MIRT1989453	hsa-miR-23b	CLIP-seq
MIRT1989454	hsa-miR-23c	CLIP-seq
MIRT1989455	hsa-miR-326	CLIP-seq
MIRT1989456	hsa-miR-330-5p	CLIP-seq
MIRT1989457	hsa-miR-342-5p	CLIP-seq
MIRT1989458	hsa-miR-412	CLIP-seq
MIRT1989459	hsa-miR-4539	CLIP-seq
MIRT1989460	hsa-miR-4651	CLIP-seq
MIRT1989461	hsa-miR-4664-5p	CLIP-seq
MIRT1989462	hsa-miR-4667-5p	CLIP-seq
MIRT1989463	hsa-miR-4700-5p	CLIP-seq
MIRT1989464	hsa-miR-4717-3p	CLIP-seq
MIRT1989465	hsa-miR-4753-3p	CLIP-seq
MIRT1989466	hsa-miR-608	CLIP-seq
MIRT1989467	hsa-miR-617	CLIP-seq
MIRT1989468	hsa-miR-637	CLIP-seq
MIRT1989469	hsa-miR-642b	CLIP-seq
MIRT1989470	hsa-miR-654-3p	CLIP-seq
MIRT1989471	hsa-miR-942	CLIP-seq
MIRT976692	hsa-miR-1262	CLIP-seq
MIRT2223796	hsa-miR-2964a-3p	CLIP-seq
MIRT976696	hsa-miR-4420	CLIP-seq
MIRT976697	hsa-miR-4452	CLIP-seq
MIRT976699	hsa-miR-4506	CLIP-seq
MIRT976701	hsa-miR-4653-3p	CLIP-seq
MIRT976703	hsa-miR-4701-3p	CLIP-seq
MIRT976706	hsa-miR-571	CLIP-seq
MIRT2387668	hsa-miR-3074-3p	CLIP-seq
MIRT2387669	hsa-miR-4690-3p	CLIP-seq
MIRT2680466	hsa-miR-329	CLIP-seq
MIRT2680467	hsa-miR-362-3p	CLIP-seq
MIRT2680468	hsa-miR-3941	CLIP-seq
MIRT2680469	hsa-miR-4789-5p	CLIP-seq
MIRT2680470	hsa-miR-603	CLIP-seq

Show/Hide all (43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001558	Process	Regulation of cell growth	IDA	10564580
GO:0001725	Component	Stress fiber	IBA
GO:0001725	Component	Stress fiber	IDA	20543869
GO:0001725	Component	Stress fiber	IEA
GO:0003779	Function	Actin binding	IEA
GO:0005515	Function	Protein binding	IPI	20543869, 25416956, 28604741, 32296183
GO:0005634	Component	Nucleus	IDA	10564580, 20543869, 28604741
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	28604741
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005925	Component	Focal adhesion	IDA	20543869
GO:0005925	Component	Focal adhesion	IEA
GO:0015629	Component	Actin cytoskeleton	IDA	28604741
GO:0015629	Component	Actin cytoskeleton	ISS
GO:0016020	Component	Membrane	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0030041	Process	Actin filament polymerization	IBA
GO:0030041	Process	Actin filament polymerization	ISS
GO:0030335	Process	Positive regulation of cell migration	IMP	20543869
GO:0031398	Process	Positive regulation of protein ubiquitination	IMP	28604741
GO:0031647	Process	Regulation of protein stability	IMP	28604741
GO:0031669	Process	Cellular response to nutrient levels	ISS
GO:0032587	Component	Ruffle membrane	IDA	20543869
GO:0032587	Component	Ruffle membrane	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IBA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IMP	20543869
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0043005	Component	Neuron projection	ISS
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0045202	Component	Synapse	ISS
GO:0050890	Process	Cognition	ISS
GO:0051017	Process	Actin filament bundle assembly	IBA
GO:0051017	Process	Actin filament bundle assembly	ISS
GO:0051895	Process	Negative regulation of focal adhesion assembly	IMP	20543869
GO:0070161	Component	Anchoring junction	IEA
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IMP	20543869
GO:0071385	Process	Cellular response to glucocorticoid stimulus	ISS
GO:1900272	Process	Negative regulation of long-term synaptic potentiation	ISS
GO:2000134	Process	Negative regulation of G1/S transition of mitotic cell cycle	IMP	28604741

MIM	HGNC	e!Ensembl
608295	30827	ENSG00000168309

O95990

Protein name

Actin-associated protein FAM107A (Down-regulated in renal cell carcinoma 1) (Protein TU3A)

Protein function

Stress-inducible actin-binding protein that plays a role in synaptic and cognitive functions by modulating actin filamentous (F-actin) dynamics. Mediates polymerization of globular actin to F-actin. Also binds to, stabilizes and bundles F-actin.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06625	DUF1151	23 → 133	Protein of unknown function (DUF1151)	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed (PubMed:10564580). Expressed in neurons (PubMed:20543869). Expressed in malignant glial tumors (PubMed:20543869). Expression is reduced or absent in a number of cancer cell lines (PubMed:10564580). {ECO:0000269|PubMed:

Sequence

MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLG
VDSKPELQRVLEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDH
APEFIKVRENLRRIATLTSEEREL

Sequence length

144

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (39)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29428674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	GWASDB_DG	21383967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	18191109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30446454, 31088707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30446454, 31088707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19787223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25230976	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33907270	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	38188687	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29555365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10564580, 10702698, 18813805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16865689, 29548818, 29858087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29548818, 29858087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	CTD_human_DG	16865689		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immune System Diseases	Immune System Diseases	GWASDB_DG	21383967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29555365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	28710449	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	28710449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	35528167	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	CTD_human_DG	16865689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19787223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30446454, 31088707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10564580, 18813805, 19787223, 20298674, 20664927		★★★★★ ★☆☆☆☆ Found in Text Mining only
mixed gliomas	Glioma	CTD_human_DG	16865689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	22190364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10564580, 18813805, 19787223, 20298674, 20664927, 21969592, 22825356, 28604741, 28710449, 29555365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	20298674, 28604741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19787223, 25753555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36124532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10564580, 10702698, 18813805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	16432833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	20453842, 22446963, 23143596		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	20453842		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	18191109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28710449	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34686626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	25182475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33753712	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

FAM107A (family with sequence similarity 107 member A)