CHI3L2 (chitinase 3 like 2)

Gene

• Entrez ID: 1117
• Gene name: Chitinase 3 like 2
• Gene symbol: CHI3L2
• Synonyms (NCBI Gene): CHIL2, YKL-39, YKL39
• Chromosome: 1
• Chromosome location: 1p13.2
• Summary: The protein encoded by this gene is similar to bacterial chitinases but lacks chitinase activity. The encoded protein is secreted and is involved in cartilage biogenesis. Several transcript variants encoding different isoforms have been found for this gen

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018662	hsa-miR-335-5p	Microarray	18185580

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004568	Function	Chitinase activity	IBA
GO:0004568	Function	Chitinase activity	IDA	22742450
GO:0005576	Component	Extracellular region	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	TAS	8702629
GO:0005975	Process	Carbohydrate metabolic process	IEA
GO:0006032	Process	Chitin catabolic process	IBA
GO:0008061	Function	Chitin binding	IDA	22742450
GO:0008061	Function	Chitin binding	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030246	Function	Carbohydrate binding	IEA

Other IDs

• MIM: 601526
• HGNC: 1933
• e!Ensembl: ENSG00000064886

Protein

• UniProt ID: Q15782
• Protein name: Chitinase-3-like protein 2 (Chondrocyte protein 39) (YKL-39)
• Protein function: Lectin that binds chitooligosaccharides and other glycans with high affinity, but not heparin. Has no chitinase activity.
• PDB: 4AY1, 4P8U, 4P8V, 4P8W, 4P8X
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00704	Glyco_hydro_18	28 → 365	Glycosyl hydrolases family 18	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highest expression in chondrocytes, followed by synoviocytes, lung and heart. Not detected in spleen, pancreas, and liver. May also be expressed in developing brain and placenta. {ECO:0000269|PubMed:8702629}.
• Sequence:

  MGATTMDQKSLWAGVVVLLLLQGGSAYKLVCYFTNWSQDRQEPGKFTPENIDPFLCSHLI
  YSFASIENNKVIIKDKSEVMLYQTINSLKTKNPKLKILLSIGGYLFGSKGFHPMVDSSTS
  RLEFINSIILFLRNHNFDGLDVSWIYPDQKENTHFTVLIHELAEAFQKDFTKSTKERLLL
  TAGVSAGRQMIDNSYQVEKLAKDLDFINLLSFDFHGSWEKPLITGHNSPLSKGWQDRGPS
  SYYNVEYAVGYWIHKGMPSEKVVMGIPTYGHSFTLASAETTVGAPASGPGAAGPITESSG
  FLAYYEICQFLKGAKITRLQDQQVPYAVKGNQWVGYDDVKSMETKVQFLKNLNLGGAMIW
  SIDMDDFTGKSCNQGPYPLVQAVKRSLGSL

• Sequence length: 390

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	32066474, 36136224	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	28989002, 31123140		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	32666680	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	12102470		★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	12972480	Associate	★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	12972480		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	12102470		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29728799, 29872578		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	38254997	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	38303405	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31810965		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	12435396, 23291184		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	37873933	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	20201406	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	20419098, 34395626	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	22211103	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35409356	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36372883	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29728799, 29872578		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	12435396		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29872578, 31810965		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	36136224	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	20201406	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	22742450	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	38303405	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31810965		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36372883	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34189853	Stimulate	★☆☆☆☆ Found in Text Mining only