WDHD1 (WD repeat and HMG-box DNA binding protein 1)

Gene

• Entrez ID: 11169
• Gene name: WD repeat and HMG-box DNA binding protein 1
• Gene symbol: WDHD1
• Synonyms (NCBI Gene): AND-1, AND1, CHTF4, CTF4
• Chromosome: 14
• Chromosome location: 14q22.2-q22.3
• Summary: The protein encoded by this gene contains multiple N-terminal WD40 domains and a C-terminal high mobility group (HMG) box. WD40 domains are found in a variety of eukaryotic proteins and may function as adaptor/regulatory modules in signal transduction, pr

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029637	hsa-miR-26b-5p	Microarray	19088304
MIRT439292	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439292	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT1489663	hsa-miR-1283	CLIP-seq
MIRT1489664	hsa-miR-3618	CLIP-seq
MIRT1489665	hsa-miR-4666-5p	CLIP-seq
MIRT1489666	hsa-miR-548ac	CLIP-seq
MIRT1489667	hsa-miR-548ae	CLIP-seq
MIRT1489668	hsa-miR-548aj	CLIP-seq
MIRT1489669	hsa-miR-548am	CLIP-seq
MIRT1489670	hsa-miR-548d-3p	CLIP-seq
MIRT1489671	hsa-miR-548x	CLIP-seq
MIRT1489672	hsa-miR-548z	CLIP-seq
MIRT1489673	hsa-miR-605	CLIP-seq
MIRT1489674	hsa-miR-934	CLIP-seq
MIRT1489675	hsa-miR-1224-3p	CLIP-seq
MIRT1489676	hsa-miR-1260	CLIP-seq
MIRT1489677	hsa-miR-1260b	CLIP-seq
MIRT1489678	hsa-miR-1280	CLIP-seq
MIRT1489679	hsa-miR-1291	CLIP-seq
MIRT1489680	hsa-miR-1322	CLIP-seq
MIRT1489681	hsa-miR-142-5p	CLIP-seq
MIRT1489682	hsa-miR-1827	CLIP-seq
MIRT1489683	hsa-miR-2276	CLIP-seq
MIRT1489684	hsa-miR-3065-5p	CLIP-seq
MIRT1489685	hsa-miR-3163	CLIP-seq
MIRT1489686	hsa-miR-3173-5p	CLIP-seq
MIRT1489687	hsa-miR-335	CLIP-seq
MIRT1489688	hsa-miR-340	CLIP-seq
MIRT1489689	hsa-miR-3612	CLIP-seq
MIRT1489690	hsa-miR-3662	CLIP-seq
MIRT1489691	hsa-miR-3921	CLIP-seq
MIRT1489692	hsa-miR-4421	CLIP-seq
MIRT1489693	hsa-miR-4422	CLIP-seq
MIRT1489694	hsa-miR-4443	CLIP-seq
MIRT1489695	hsa-miR-4653-5p	CLIP-seq
MIRT1489696	hsa-miR-4733-5p	CLIP-seq
MIRT1489697	hsa-miR-4766-5p	CLIP-seq
MIRT1489698	hsa-miR-4772-3p	CLIP-seq
MIRT1489699	hsa-miR-4796-5p	CLIP-seq
MIRT1489700	hsa-miR-488	CLIP-seq
MIRT1489701	hsa-miR-505	CLIP-seq
MIRT1489666	hsa-miR-548ac	CLIP-seq
MIRT1489667	hsa-miR-548ae	CLIP-seq
MIRT1489668	hsa-miR-548aj	CLIP-seq
MIRT1489669	hsa-miR-548am	CLIP-seq
MIRT1489670	hsa-miR-548d-3p	CLIP-seq
MIRT1489671	hsa-miR-548x	CLIP-seq
MIRT1489672	hsa-miR-548z	CLIP-seq
MIRT1489673	hsa-miR-605	CLIP-seq
MIRT1489702	hsa-miR-650	CLIP-seq
MIRT2147639	hsa-miR-299-3p	CLIP-seq
MIRT2147640	hsa-miR-3125	CLIP-seq
MIRT2147641	hsa-miR-3149	CLIP-seq
MIRT2147642	hsa-miR-3916	CLIP-seq
MIRT2147643	hsa-miR-4476	CLIP-seq
MIRT2147644	hsa-miR-4491	CLIP-seq
MIRT2147645	hsa-miR-4533	CLIP-seq
MIRT2147646	hsa-miR-4657	CLIP-seq
MIRT2147647	hsa-miR-4795-3p	CLIP-seq
MIRT2147648	hsa-miR-548aa	CLIP-seq
MIRT2147649	hsa-miR-593	CLIP-seq
MIRT2147650	hsa-miR-598	CLIP-seq
MIRT2147651	hsa-miR-877	CLIP-seq
MIRT1489680	hsa-miR-1322	CLIP-seq
MIRT2147639	hsa-miR-299-3p	CLIP-seq
MIRT2463365	hsa-miR-4474-3p	CLIP-seq
MIRT2147644	hsa-miR-4491	CLIP-seq
MIRT2147646	hsa-miR-4657	CLIP-seq
MIRT2463366	hsa-miR-604	CLIP-seq
MIRT2463367	hsa-miR-647	CLIP-seq
MIRT2661494	hsa-miR-3160-5p	CLIP-seq
MIRT2661495	hsa-miR-3920	CLIP-seq
MIRT2661496	hsa-miR-4420	CLIP-seq
MIRT2661497	hsa-miR-4426	CLIP-seq
MIRT2661498	hsa-miR-4647	CLIP-seq
MIRT2661499	hsa-miR-4662b	CLIP-seq
MIRT2661500	hsa-miR-4704-3p	CLIP-seq
MIRT2661494	hsa-miR-3160-5p	CLIP-seq
MIRT2661495	hsa-miR-3920	CLIP-seq
MIRT2661496	hsa-miR-4420	CLIP-seq
MIRT2661497	hsa-miR-4426	CLIP-seq
MIRT2661498	hsa-miR-4647	CLIP-seq
MIRT2661499	hsa-miR-4662b	CLIP-seq
MIRT2661500	hsa-miR-4704-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000278	Process	Mitotic cell cycle	IBA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	9175701
GO:0003682	Function	Chromatin binding	IBA
GO:0005515	Function	Protein binding	IPI	21725360
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS	9175701
GO:0005737	Component	Cytoplasm	TAS	9175701
GO:0006261	Process	DNA-templated DNA replication	IBA
GO:0006261	Process	DNA-templated DNA replication	IEA
GO:0006281	Process	DNA repair	IBA
GO:0043596	Component	Nuclear replication fork	IBA

Other IDs

• MIM: 608126
• HGNC: 23170
• e!Ensembl: ENSG00000198554

Protein

• UniProt ID: O75717
• Protein name: WD repeat and HMG-box DNA-binding protein 1 (Acidic nucleoplasmic DNA-binding protein 1) (And-1)
• Protein function: Core replisome component that acts as a replication initiation factor. Binds directly to the CMG complex and functions as a hub to recruit additional proteins to the replication fork. {ECO:0000269|PubMed:19805216, ECO:0000269|PubMed:34694004, EC
• PDB: 2D7L, 5GVA, 5GVB, 5OGS, 6XTY, 7PFO, 7PLO, 8B9D
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00400	WD40	7 → 41	WD domain, G-beta repeat	Repeat
  PF00400	WD40	126 → 164	WD domain, G-beta repeat	Repeat
  PF12894	ANAPC4_WD40	192 → 284	Anaphase-promoting complex subunit 4 WD40 domain	Repeat
  PF12341	Mcl1_mid	431 → 715	Minichromosome loss protein, Mcl1, middle region	Family

• Sequence:

  MPATRKPMRYGHTEGHTEVCFDDSGSFIVTCGSDGDVRIWEDLDDDDPKFINVGEKAYSC
  ALKSGKLVTAVSNNTIQVHTFPEGVPDGILTRFTTNANHVVFNGDGTKIAAGSSDFLVKI
  VDVMDSSQQKTFRGHDAPVLSLSFDPKDIFLASASCDGSVRVWQISDQTCAISWPLLQKC
  NDVINAKSICRLAWQPKSGKLLAIPVEKSVKLYRRESWSHQFDLSDNFISQTLNIVTWSP
  CGQYLAAGSINGLIIVWNVETKDCMERVKHEKGYAICGLAWHPTCGRISYTDAEGNLGLL
  ENVCDPSGKTSSSKVSSRVEKDYNDLFDGDDMSNAGDFLNDNAVEIPSFSKGIINDDEDD
  EDLMMASGRPRQRSHILEDDENSVDISMLKTGSSLLKEEEEDGQEGSIHNLPLVTSQRPF
  YDGPMPTPRQKPFQSGSTPLHLTHRFMVWNSIGIIRCYNDEQDNAIDVEFHDTSIHHATH
  LSNTLNYTIADLSHEAILLACESTDELASKLHCLHFSSWDSSKEWIIDLPQNEDIEAICL
  GQGWAAAATSALLLRLFTIGGVQKEVFSLAGPVVSMAGHGEQLFIVYHRGTGFDGDQCLG
  VQLLELGKKKKQILHGDPLPLTRKSYLAWIGFSAEGTPCYVDSEGIVRMLNRGLGNTWTP
  ICNTREHCKGKSDHYWVVGIHENPQQLRCIPCKGSRFPPTLPRPAVAILSFKLPYCQIAT
  EKGQMEEQFWRSVIFHNHLDYLAKNGYEYEESTKNQATKEQQELLMKMLALSCKLEREFR
  CVELADLMTQNAVNLAIKYASRSRKLILAQKLSELAVEKAAELTATQVEEEEEEEDFRKK
  LNAGYSNTATEWSQPRFRNQVEEDAEDSGEADDEEKPEIHKPGQNSFSKSTNSSDVSAKS
  GAVTFSSQGRVNPFKVSASSKEPAMSMNSARSTNILDNMGKSSKKSTALSRTTNNEKSPI
  IKPLIPKPKPKQASAASYFQKRNSQTNKTEEVKEENLKNVLSETPAICPPQNTENQRPKT
  GFQMWLEENRSNILSDNPDFSDEADIIKEGMIRFRVLSTEERKVWANKAKGETASEGTEA
  KKRKRVVDESDETENQEEKAKENLNLSKKQKPLDFSTNQKLSAFAFKQE

• Sequence length: 1129

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DRY EYE SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WDHD1-related disorder	Uncertain significance; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	28618970		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	30115827		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	30115827		★☆☆☆☆ Found in Text Mining only
Alexander Disease	Alexander Disease	BEFREE	20544858		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	15768036		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	31031654		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28391138, 31262226		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28391138, 31262226		★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	31849154		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	25913104, 27913247, 28119390, 29173444, 30478238, 31469258, 31826246		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30049611		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	29281086, 29861295		★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	BEFREE	28382081		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28673589, 31247885		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11996903, 25124574, 28151039		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25124574	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32883234	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37759234	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28758857, 31632059		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	25124574		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29709994		★☆☆☆☆ Found in Text Mining only
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	28162100		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28181217, 28264833, 29861295, 31818229		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	28618970		★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	23390603	Associate	★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	30677763		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29228950, 29503539		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	30314946		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29446691		★☆☆☆☆ Found in Text Mining only
Corneal dystrophy, Lattice type 3	Corneal Dystrophy	BEFREE	29086671		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	21937044		★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	28851416		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	27974719		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	28176297		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28391138, 29376462, 31262226		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	21586423, 29211592, 29529689, 30760425		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	21586423, 29211592, 29529689, 30760425		★☆☆☆☆ Found in Text Mining only
Diffuse Scleroderma	Scleroderma	BEFREE	30852552		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	29211592		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine System Diseases	BEFREE	29757421		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	37759234	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Atresia	Esophageal Atresia	BEFREE	28012691		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	33345608	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	26877610		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29446691		★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	19817879, 30888200		★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	16271962		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	26311091		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30053515		★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	Pubtator	32728162	Associate	★☆☆☆☆ Found in Text Mining only
Incontinentia Pigmenti Achromians	Incontinentia Pigmenti Achromians	BEFREE	21811407		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28143594		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	30677763		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	21586423		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	2207323, 29673891		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	30347466		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	29782426		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	19874868		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11996903, 25124574, 28151039		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28758857, 31632059		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26868260		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21725360, 29438370, 29672191		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30945965		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28391138, 29376462, 31262226		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	29254550		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29778565		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	30192155		★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine with Aura	BEFREE	28181217		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	19204158, 28176297, 28646686		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	27384327		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	28251836		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	36345604	Stimulate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21674652, 22203582, 26530913, 28139264		★☆☆☆☆ Found in Text Mining only
Neurogenic Urinary Bladder	Neurogenic Urinary Bladder	BEFREE	30924184		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	29529689		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	30347466		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	29376462		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29778565		★☆☆☆☆ Found in Text Mining only
Optic Neuropathy	Optic Neuropathy	BEFREE	28527030		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	27649930		★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	16271962		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	2141875		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	31294471		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	28453606		★☆☆☆☆ Found in Text Mining only
Pharyngitis	Pharyngitis	BEFREE	30798778, 30921525		★☆☆☆☆ Found in Text Mining only
Polyneuropathy, Motor	Polyneuropathy	BEFREE	29343286		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	31850650		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	28618970		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	28176297		★☆☆☆☆ Found in Text Mining only
Primary amyloidosis	Amyloidosis	BEFREE	30354284		★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	19962985		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	31262226, 31849154		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	29376462		★☆☆☆☆ Found in Text Mining only
Sacroiliitis	Sacroiliitis	BEFREE	30343531		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	14755439, 31366251		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin lesion	Skin Lesion	BEFREE	30373888		★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	30343531		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34999279	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26868260		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	28181217		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	33221821	Associate	★☆☆☆☆ Found in Text Mining only
XX males	XX Males	BEFREE	21912980		★☆☆☆☆ Found in Text Mining only