Gene Gene information from NCBI Gene database.
Entrez ID 11167
Gene name Follistatin like 1
Gene symbol FSTL1
Synonyms (NCBI Gene)
FRPFSL1MIR198OCC-1OCC1tsc36
Chromosome 3
Chromosome location 3q13.33
Summary This gene encodes a protein with similarity to follistatin, an activin-binding protein. It contains an FS module, a follistatin-like sequence containing 10 conserved cysteine residues. This gene product is thought to be an autoantigen associated with rheu
miRNA miRNA information provided by mirtarbase database.
1271
miRTarBase ID miRNA Experiments Reference
MIRT020891 hsa-miR-155-5p Proteomics 18668040
MIRT001789 hsa-miR-206 Reporter assay 17030984
MIRT022846 hsa-miR-124-3p Microarray 18668037
MIRT029771 hsa-miR-26b-5p Microarray 19088304
MIRT051922 hsa-let-7b-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 19060904, 20860622, 22265692, 25416956, 32296183, 32814053
GO:0005576 Component Extracellular region IBA
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605547 3972 ENSG00000163430
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q12841
Protein name Follistatin-related protein 1 (Follistatin-like protein 1)
Protein function Secreted glycoprotein that is involved in various physiological processes, such as angiogenesis, regulation of the immune response, cell proliferation and differentiation (PubMed:22265692, PubMed:29212066). Plays a role in the development of the
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09289 FOLN 31 52 Follistatin/Osteonectin-like EGF domain Domain
PF07648 Kazal_2 53 98 Kazal-type serine protease inhibitor domain Domain
Tissue specificity TISSUE SPECIFICITY: Overexpressed in synovial tissues from rheumatoid arthritis (PubMed:15638044). {ECO:0000269|PubMed:15638044}.
Sequence
MWKRWLALALALVAVAWVRAEEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKP
HKRPVCGSNGKTYLNHCELHRDACLTGSKIQVDYDGHC
KEKKSVSPSASPVVCYQSNRDE
LRRRIIQWLEAEIIPDGWFSKGSNYSEILDKYFKNFDNGDSRLDSSEFLKFVEQNETAIN
ITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETY
ADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTRYVQELQKHQETAEKT
KRVSTKEI
Sequence length 308
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Signaling by BMP
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
5
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
AORTIC VALVE INSUFFICIENCY CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SCLERODERMA, SYSTEMIC CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute Coronary Syndrome Coronary Syndrome BEFREE 22675198, 30864520
★☆☆☆☆
Found in Text Mining only
Acute Kidney Insufficiency Acute Kidney Insufficiency CTD_human_DG 20861081
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 23354517, 26553359, 28765921, 28852126, 30138108, 31402959, 31653686
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma, Clear Cell Adenocarcinoma BEFREE 2354825
★☆☆☆☆
Found in Text Mining only
Aortic Valve Disease Aortic valve disease Pubtator 30722102 Associate
★☆☆☆☆
Found in Text Mining only
Aortic Valve Insufficiency Aortic Valve Insufficiency CTD_human_DG 21216836
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Arteriovenous Malformations Arteriovenous malformations Pubtator 36012380 Associate
★☆☆☆☆
Found in Text Mining only
Arthritis Arthritis BEFREE 19109154, 22117761, 24838142, 29594389
★☆☆☆☆
Found in Text Mining only
Arthritis Arthritis Pubtator 21303509, 22117761 Associate
★☆☆☆☆
Found in Text Mining only
Arthritis Juvenile Juvenile arthritis Pubtator 23678162 Stimulate
★☆☆☆☆
Found in Text Mining only