Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	11145
Gene name	Phospholipase A and acyltransferase 3
Gene symbol	PLAAT3
Synonyms (NCBI Gene)	AdPLAFPLD9H-REV107H-REV107-1HRASLS3HREV107HREV107-1HREV107-3HRSL3PLA2G16PLAAT-3
Chromosome	11
Chromosome location	11q12.3-q13.1

Show/Hide all (63)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004620	Function	Phospholipase activity	IEA
GO:0004623	Function	Phospholipase A2 activity	IBA
GO:0004623	Function	Phospholipase A2 activity	IDA	19047760, 20100577, 22825852
GO:0004623	Function	Phospholipase A2 activity	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 17374643, 25416956, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IEA
GO:0005635	Component	Nuclear envelope	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005764	Component	Lysosome	IEA
GO:0005764	Component	Lysosome	ISS
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005777	Component	Peroxisome	IEA
GO:0005777	Component	Peroxisome	ISS
GO:0005778	Component	Peroxisomal membrane	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006641	Process	Triglyceride metabolic process	IEA
GO:0006641	Process	Triglyceride metabolic process	ISS
GO:0006644	Process	Phospholipid metabolic process	IDA	20100577
GO:0006644	Process	Phospholipid metabolic process	IEA
GO:0007031	Process	Peroxisome organization	IEA
GO:0007031	Process	Peroxisome organization	ISS
GO:0008289	Function	Lipid binding	EXP	22605381
GO:0008654	Process	Phospholipid biosynthetic process	IEA
GO:0008970	Function	Phospholipase A1 activity	IBA
GO:0008970	Function	Phospholipase A1 activity	IDA	19047760, 22825852
GO:0008970	Function	Phospholipase A1 activity	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0016020	Component	Membrane	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016042	Process	Lipid catabolic process	ISS
GO:0016410	Function	N-acyltransferase activity	IBA
GO:0016410	Function	N-acyltransferase activity	IDA	22825852
GO:0016410	Function	N-acyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	TAS
GO:0016787	Function	Hydrolase activity	IEA
GO:0030397	Process	Membrane disassembly	IEA
GO:0030397	Process	Membrane disassembly	ISS
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0036152	Process	Phosphatidylethanolamine acyl-chain remodeling	TAS
GO:0046485	Process	Ether lipid metabolic process	IEA
GO:0046485	Process	Ether lipid metabolic process	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0070292	Process	N-acylphosphatidylethanolamine metabolic process	IBA
GO:0070292	Process	N-acylphosphatidylethanolamine metabolic process	IDA	22825852
GO:0070292	Process	N-acylphosphatidylethanolamine metabolic process	IEA
GO:0070306	Process	Lens fiber cell differentiation	IEA
GO:0070306	Process	Lens fiber cell differentiation	ISS
GO:1903008	Process	Organelle disassembly	IEA
GO:1903008	Process	Organelle disassembly	ISS
GO:1904177	Process	Regulation of adipose tissue development	IEA
GO:1904177	Process	Regulation of adipose tissue development	ISS

MIM	HGNC	e!Ensembl
613867	17825	ENSG00000176485

P53816

Protein name

Phospholipase A and acyltransferase 3 (EC 2.3.1.-) (EC 3.1.1.32) (EC 3.1.1.4) (Adipose-specific phospholipase A2) (AdPLA) (Group XVI phospholipase A1/A2) (H-rev 107 protein homolog) (H-REV107) (HREV107-1) (HRAS-like suppressor 1) (HRAS-like suppressor 3)

Protein function

Exhibits both phospholipase A1/2 and acyltransferase activities (PubMed:19047760, PubMed:19615464, PubMed:22605381, PubMed:22825852, PubMed:26503625). Shows phospholipase A1 (PLA1) and A2 (PLA2) activity, catalyzing the calcium-independent relea

PDB

2KYT , 4DOT , 4FA0 , 4Q95 , 7C3Z , 7C41 , 7ZOM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04970	LRAT	6 → 126	Lecithin retinol acyltransferase	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Low expression, if any, in hematopoietic cells and thymus. In testis, confined to round spermatids. Expressed in normal ovarian epithelial cells. Down-regulated in some ovarian carcinomas and testicular germ cell tumo

Sequence

MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIV
KKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNEL
RYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ

Sequence length

162

Interactions

View interactions

	KEGG		Reactome
	Glycerophospholipid metabolism Ether lipid metabolism Arachidonic acid metabolism Linoleic acid metabolism alpha-Linolenic acid metabolism Metabolic pathways Ras signaling pathway Regulation of lipolysis in adipocytes		Acyl chain remodelling of PC Acyl chain remodelling of PS Acyl chain remodelling of PE Acyl chain remodelling of PI

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Lipodystrophy, familial partial, type 9	Pathogenic	rs2495548886, rs373632324	RCV003493366 RCV003493367	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LIPODYSTROPHY-DEMYELINATING PERIPHERAL SENSORY-MOTOR NEUROPATHY SYNDROME	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (19)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	28523155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34715882	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30343388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	33880967	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	17003497	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	25347447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28523155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	17374643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31233548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31233548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	37400835	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	17689134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10687848, 11973642, 17374643, 17689134, 19636513, 26933804, 28743497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25024203, 25993412, 26933804, 29181064, 30655907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	25993412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34389782	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31233548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31233548	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	24884338	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PLAAT3 (phospholipase A and acyltransferase 3)